KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_4454Help
Entry
ECUMN_4454        CDS       T00831                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ECUMN_4454 (glpK)
Enzymes [BR:eum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ECUMN_4454 (glpK)
Exosome [BR:eum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECUMN_4454 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4601092..4602600)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDG
LEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYAGWKKAVKRAMAWEEHDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtc
gtaatggatcacgatgccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctac
ccaaaaccaggctgggtagaacacgacccaatggaaatctgggccacccaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagttccgatcaaattgcagctatcggtatt
acgaaccagcgtgaaaccactattgtctgggaaaaagaaaccggcaagcctatctataac
gccattgtctggcagtgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggt
ttagaagattatatccgcagcaataccggtctggtgattgacccgtacttctctggcacc
aaagtgaagtggatcctcgaccatgtggaaggctctcgcgaacgtgcgcgtcgtggtgaa
ttgctgtttggtacggttgatacgtggcttatctggaaaatgactcagggccgtgtccat
gtgaccgattacaccaacgcctctcgtaccatgttgttcaacatccataccctggactgg
gacgacaaaatgctggaagtgctggatattccgcgcgagatgctgccagaagtgcgtcgt
tcttccgaagtgtacggtcagactaacattggcggcaaaggcggcacgcgtattccaatc
tccgggatcgccggtgaccagcaggccgcgctgtttggtcagttgtgcgtgaaagaaggg
atggcgaagaatacctacggcactggctgctttatgctgatgaacaccggcgagaaagcg
gtgaaatcagaaaacggcctgctgaccaccatcgcctgtggcccaactggcgaagtaaac
tatgcgctggaaggtgcggtgtttatggcgggcgcatccattcagtggctgcgcgatgag
atgaagttgattaacgacgcgtacgattccgaatatttcgccaccaaagtgcaaaacacc
aatggtgtatatgtggttccggcatttaccgggctgggtgcgccatactgggatccgtat
gcgcgcggggcgattttcggcttaacgcgtggagtgaacgctaaccacattatccgcgcg
acgctggagtctattgcttatcagacgcgtgacgtactggaagcaatgcaggccgactcc
ggtattcgtctgcacgcgctgcgcgtggatggcggtgcagtagcaaacaatttcctgatg
cagttccagtccgatattctcggtacccgcgttgagcgcccggaagtgcgcgaagttacc
gcattgggtgcggcctatcttgctggtctggcggttggcttctggcagaatctcgacgag
ctgcaagagaaagcggtgattgagcgcgagttccgtccaggcatcgaaaccactgagcgt
aattaccgttacgcaggctggaaaaaagcggtcaaacgcgcgatggcgtgggaagaacac
gacgagtaa

DBGET integrated database retrieval system