KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_4540Help
Entry
ECUMN_4540        CDS       T00831                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00620  Pyruvate metabolism
eum00630  Glyoxylate and dicarboxylate metabolism
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01120  Microbial metabolism in diverse environments
eum01200  Carbon metabolism
Module
eum_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECUMN_4540 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECUMN_4540 (aceB)
Enzymes [BR:eum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECUMN_4540 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 7157100
NCBI-ProteinID: YP_002415147
UniProt: B7NFV0
Structure
PDB: 

Jmol
Position
4704234..4705835
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFIRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASIRDADWKIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcataaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgaactggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaggatatcgataac
ggaacgttgcctgattttatttcggaaacagcttccattcgtgatgctgactggaaaatt
cgtggtattcccgcggacttacaagatcgtcgggtagagattaccggcccggttgagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggccccggactggaacaaagtgatcgacgggcaaattaacctgcgtgatgcagtt
aacggcaccatcagctataccaatgaagcaggcaaaatttaccagctcaagcccaatcca
gcggtgttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggtagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagcggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggacgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagttatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaacccttcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggtatggcggcatttattccgagcaaagatgaagag
cgcaataaccaggtgctcaacaaagtaaaagcggataaatcgctggaagctaataacggt
cacgatggcacatggattgcccacccaggccttgcggatacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggctgtgcagtacatcgaagcatggatctctggcaacggctgtgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcgatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgaccaaagccttgttccgc
cagatgctgggcgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system