KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_4621Help
Entry
ECUMN_4621        CDS       T00831                                 

Definition
putative ribose-5-phosphate isomerase B
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:eum01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eum01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eum00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eum00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4799700..4800017
Genome map
AA seq 105 aa AA seqDB search
MQPVFFIKKRTGAMGGHVAGTAGFCVAVPAFYSWSMSEGIDKETRSSERTDYPHYASEVA
LAFGSRVVGLELAKMIVDAWLGAQYEGGSHQQRVEAITAIEQRRN
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccggtgttttttattaaaaaacgtaccggagcaatgggcggtcatgtcgctggc
accgcaggattctgcgttgctgtgccagccttttattcatggtcaatgagtgaggggatt
gataaagaaaccaggtcgtcagagcgcactgattatccgcattacgccagtgaagttgca
ctggcttttggttcacgagtggttggcctcgaactggcaaaaatgattgtcgatgcgtgg
ctgggcgcacagtacgaaggcggtagtcatcaacaacgcgtggaggcgattacggcaata
gagcagcggagaaattga

DBGET integrated database retrieval system