KEGG   Escherichia coli UMNK88: UMNK88_1378Help
Entry
UMNK88_1378       CDS       T02001                                 

Definition
beta-hexosaminidase NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eun  Escherichia coli UMNK88
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UMNK88_1378
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    UMNK88_1378
Enzymes [BR:eun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UMNK88_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344851..1345876
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNRLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALSGMEEGGKLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETP
CDPRPQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRQELMDSARWKAISTRLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaata
ctggcgcatccgctggtgggagggctgattctctttacgcgtaactatcatgatcctgcc
cagttacgtgaactggtgcgccagatccgcgcagcttcgcgcaatcgtctggtggtggcg
gttgatcaggaaggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcg
gcgcaatcattcgctgcgctgtcaggaatggaagagggtggcaaactggcgcaggaggca
ggttggttgatggccagcgaaatgatcgctatggatattgatatcagctttgcgcctgtg
ctggatgtcgggcatatcagcgcggcgattggcgagcgttcttatcatgccgatccacaa
aaagccctggcaattgccagccggtttattgatggtatgcatgaagccggaatgaaaacg
accgggaaacacttcccaggacacggtgcagtaacggcagactcacacaaagaaacaccg
tgcgatccacgtccacaagcggagattcgcgctaaagatatgtcggtcttcagttcctta
atccgcgaaaataaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgat
ccgcgtccggcgagcggttctccctactggctgaaaaccgttttgcgtcaggaactgggt
tttgacggcgtgattttctctgacgatttatcgatggaaggtgccgcgattatgggcagt
tatgccgaacgcgggcaggcttcactggatgcgggttgcgatatgatcctggtctgcaat
aatcgtaaaggggccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgtt
acacgtttgtatcataaaggttcattttcgcgacaggaactgatggactcggctcgctgg
aaagcgatcagcacccgtctgaatcagttacatgaacgctggcaggaagagaaagcaggt
cactaa

DBGET integrated database retrieval system