KEGG   Escherichia coli UMNK88: UMNK88_1590Help
Entry
UMNK88_1590       CDS       T02001                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eun  Escherichia coli UMNK88
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UMNK88_1590 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMNK88_1590 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMNK88_1590 (trpA)
Enzymes [BR:eun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UMNK88_1590 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1534140..1534916)
Genome map
AA seq 258 aa AA seqDB search
MKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLR
AFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVAD
VPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAA
LPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEK
MLAALKVFVQPMKAATRS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagcgcaaagaaggcgcattcgttcctttcgtcacgctcggtgatccgggcatt
gagcagtcattgaaaattatcgatacgctaattgaagccggtgctgacgcgctggagtta
ggtatccccttctccgacccactggcggatggcccgacgattcaaaacgccactctgcgc
gcctttgcggcaggtgtgactccggcacaatgttttgaaatgctggcactgattcgccag
aaacacccgaccattcccattggcctgttgatgtatgccaatctggtgtttaacaaaggc
attgatgagttttatgcccagtgcgaaaaagtcggcgtcgattcggtgctggttgccgat
gtgccagttgaagagtccgcgcccttccgccaggccgcgttgcgtcataatgtcgcacct
atcttcatctgcccgccaaatgccgatgacgacctgctgcgccagatagcctcttacggt
cgtggttacacctatttgctgtcacgagcaggcgtgaccggcgcagaaaaccgcgccgcg
ttacccctcaatcatctggttgcgaagctgaaagagtacaacgctgcacctccattgcag
ggatttggtatttccgccccggatcaggtaaaagcagcgattgatgcaggagctgcgggc
gcgatttctggttcggccattgttaaaatcatcgagcaacatattaatgagccagagaaa
atgctggcggcactgaaagtttttgtacaaccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system