KEGG   Escherichia coli UMNK88: UMNK88_1590Help
Entry
UMNK88_1590       CDS       T02001                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00260  Glycine, serine and threonine metabolism
eun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01130  Biosynthesis of antibiotics
eun01230  Biosynthesis of amino acids
Module
eun_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMNK88_1590 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMNK88_1590 (trpA)
Enzymes [BR:eun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UMNK88_1590 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEE56187
UniProt: A0A0E0TXV7
Structure
PDB: 

Jmol
Position
complement(1534140..1534916)
Genome map
AA seq 258 aa AA seqDB search
MKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLR
AFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVAD
VPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAA
LPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEK
MLAALKVFVQPMKAATRS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagcgcaaagaaggcgcattcgttcctttcgtcacgctcggtgatccgggcatt
gagcagtcattgaaaattatcgatacgctaattgaagccggtgctgacgcgctggagtta
ggtatccccttctccgacccactggcggatggcccgacgattcaaaacgccactctgcgc
gcctttgcggcaggtgtgactccggcacaatgttttgaaatgctggcactgattcgccag
aaacacccgaccattcccattggcctgttgatgtatgccaatctggtgtttaacaaaggc
attgatgagttttatgcccagtgcgaaaaagtcggcgtcgattcggtgctggttgccgat
gtgccagttgaagagtccgcgcccttccgccaggccgcgttgcgtcataatgtcgcacct
atcttcatctgcccgccaaatgccgatgacgacctgctgcgccagatagcctcttacggt
cgtggttacacctatttgctgtcacgagcaggcgtgaccggcgcagaaaaccgcgccgcg
ttacccctcaatcatctggttgcgaagctgaaagagtacaacgctgcacctccattgcag
ggatttggtatttccgccccggatcaggtaaaagcagcgattgatgcaggagctgcgggc
gcgatttctggttcggccattgttaaaatcatcgagcaacatattaatgagccagagaaa
atgctggcggcactgaaagtttttgtacaaccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system