KEGG   Escherichia coli UMNK88: UMNK88_1645Help
Entry
UMNK88_1645       CDS       T02001                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eun  Escherichia coli UMNK88
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UMNK88_1645
Enzymes [BR:eun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     UMNK88_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587944..1589623
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILELVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKHHSKEITRELNDEATLRHAVYHELSRLITLC
RSHNEFHPDNNFTIDTINSSVMRIQRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISE
VDILGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagc
aatgatttaaaaccattacccacatttaatcagttttaccatcaatggctgcaaagcatt
ttttcacatgttcatttgttgccgttttatccatggtcatctgatgatggcttttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcatccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttgctggcgatggtggatgttttactctgttaccttgcg
aaaggtgctgagtatgtccgcctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgttgcgccaggtacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgcaggcgatgacgaagcacatatggtgtaccagttctcgctgccgcca
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggctaaacccgctacggggcttgttgcctgaaagcgaaatattagagctggtcgaggcg
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacacgcagtccg
tatgaaataaatgtgacctatatggatgcgttaagccgccgtgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattcttggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaacatcacagtaaagagataacccgagaactgaac
gatgaagctacattaaggcatgcggtatatcatgagttgtcgcgtttaattacactttgt
cgcagccataacgagtttcatccggataataattttaccattgatacgattaattcatcc
gtaatgcgtattcaaagaagtaacgctgatggtaattgtctgactggattgtttaatgtc
agtaaaaatattcagcatgtaaatattactaatctgcatggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system