KEGG   Escherichia coli UMNK88: UMNK88_1738Help
Entry
UMNK88_1738       CDS       T02001                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eun  Escherichia coli UMNK88
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1642941..1643432
Genome map
AA seq 163 aa AA seqDB search
MISQSLKNKIIAAAAGGAIAIAAVMVKPLEGVEYDPYRDVIGVWTVCYGHTGKDIMLGKT
YTQSECDALLNKDLHKTAKAIDPYIKVEISDFTRAALYSFAYNVGATNFKTSTLLKLLND
GKKSEACAQLKRWVYAGGKKWQGLVNRRDVEYAVCEWGETWTR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattagccaatcgctgaagaataagattattgctgcggcggctggtggggcgatcgct
attgcggcggtgatggttaaaccattagagggcgtggagtacgatccctatcgtgatgtt
atcggcgtatggacagtttgctatggtcacaccggaaaagacatcatgcttggtaagact
tacacgcaatcagaatgcgatgctttgttaaacaaggatctccacaaaaccgcaaaagcg
attgacccatatattaaagtcgaaatatcagattttacccgcgcggcgctttattcattc
gcctataacgtaggcgctaccaacttcaaaacatcaaccttattgaagctactcaatgac
ggcaagaaatcagaggcgtgcgcacagcttaaacgctgggtatacgctggcggtaagaag
tggcaaggcctggttaaccgccgtgatgttgaatatgccgtttgcgaatggggtgaaaca
tggacaaggtga

DBGET integrated database retrieval system