KEGG   Escherichia coli UMNK88: UMNK88_2173Help
Entry
UMNK88_2173       CDS       T02001                                 

Definition
vitamin B12 transport periplasmic protein BtuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eun  Escherichia coli UMNK88
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    UMNK88_2173
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UMNK88_2173
Enzymes [BR:eun01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     UMNK88_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2097734..2098285)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKFAGNVLLIVNVASKCGLTPQYEQLENIQKAWVDRGFMV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagttcgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggtcgatcgaggttttatggtg
ctgggattcccgtgcaaccagtttctggaacaagaaccgggcagcgatgaagagattaaa
acttactgtaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggccgtgcaccgctgtacccg
gatgatattttatggaattttgaaaaattcctggttggcagggacggaaaagtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system