KEGG   Escherichia coli UMNK88: UMNK88_2587Help
Entry
UMNK88_2587       CDS       T02001                                 

Gene name
galF
Definition
(GenBank) regulatory protein GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00040  Pentose and glucuronate interconversions
eun00052  Galactose metabolism
eun00500  Starch and sucrose metabolism
eun00520  Amino sugar and nucleotide sugar metabolism
eun01100  Metabolic pathways
eun01130  Biosynthesis of antibiotics
Module
eun_M00362  Nucleotide sugar biosynthesis, prokaryotes
eun_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UMNK88_2587 (galF)
   00052 Galactose metabolism
    UMNK88_2587 (galF)
   00500 Starch and sucrose metabolism
    UMNK88_2587 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    UMNK88_2587 (galF)
Enzymes [BR:eun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UMNK88_2587 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: AEE57157
UniProt: A0A0E0U0M4
Position
complement(2464621..2465514)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLELRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtctagggatgcatatgttgcctgct
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaaa
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaactgcgc
gtgaagcgtcagctgctggcggaagtacagtccatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttaggccactccattttgtgtgcacgacccgcc
attggtgacaacccatttgttgtggtattgccggacgttgtgatcgacgacgccagtgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcatcgtcgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gctattgccgagctggcgaaaaaacagtccgttgatgccatgctgatgactggggacagt
tacgactgcggtaaaaaaatgggttatatgcaggcatttgtgaagtatggactacgcaac
ctcaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system