KEGG   Escherichia coli UMNK88: UMNK88_3595Help
Entry
UMNK88_3595       CDS       T02001                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eun  Escherichia coli UMNK88
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eun00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3477190..3478623
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggcaaatactatcca
aaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctatttgccgaa
atgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaaggtgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaactgctg
aaatacaacatcgaaccggtgataaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtcgttgatttctttgtccgtttcgcggaa
gtggtattcgaacgctacaagcataaagtcaaatactggatgaccttcaacgaaataaac
aaccagcgtaactggcgtgcgccgctgtttggttactgctgctccggcgtggtgtatacc
gagcatgacaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtcgccagc
gccctggcagtgaaagccgcgcgtcgcattaacccggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcctat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatggcgatctggat
gtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaacgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccgaacccg
tatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctatgccctt
tgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatattgaagagatgaaaaaagcagtgacttacgatggtgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtgtcattcactaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system