KEGG   Escherichia coli UMNK88: UMNK88_4100Help
Entry
UMNK88_4100       CDS       T02001                                 

Definition
hypothetical protein
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
eun  Escherichia coli UMNK88
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eun00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3954553..3957246)
Genome map
AA seq 897 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANGGSATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKSNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPSPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEISQYGNPGSCSVKPDN
NGGAVTPVDPTPETPVTPTPDNSEPSTPADSVNDYSLQAWSGQEGSEIYHVIFNGNVYKN
AWWVGSKDCPRGTSAENSNNPWRLERTATAAELSQYGNPTTCEIDNGGVIVADGFQASKA
YSADSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVDGQA
YEALFWTQSDNPALVANQNATGSNSRPWKPLGKAQSYSNEELNNAPQFNPETLYASDTLI
RFNGVNYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTLNTI
PDLAALAKNHNVNHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALREAGGDVMLS
IGGANNAPLAASCKNVDDLMQHYYDIVDNLNLKVLDFDIEGTWVADQASIERRNLAVKKV
QDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSA
NTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDA
RLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgcctgcatccaatacgccggctaatggcggttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcagacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcctggtgggtagcctcttctaactgt
ccgggtgatgcgaaaagcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcctgtacttcagcaccacagccttca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtagtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctataacggcggcatttataagaacgcctggtgggtaggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagtaacccatggcgttatgttcgcgcggca
acggcaacagaaatcagccagtatggtaaccctggctcctgttccgttaagccggataat
aatggcggtgctgtgactccggttgatccaactccggaaacaccggtgaccccaactccg
gataacagcgagccatcaacaccagcggatagcgttaacgattactcattgcaagcgtgg
agcggccaggaaggtagcgaaatttaccatgttattttcaatggtaatgtttacaagaac
gcctggtgggttgggtctaaagattgcccacggggtaccagcgctgaaaactccaataac
ccatggcgtctcgagcgtacagctaccgctgcggaattgagtcagtacggtaacccgact
acctgtgaaattgataacggcggcgtcattgttgcggatggtttccaggccagcaaagcg
tacagcgcggacagcatcgtagattataacgatgcacattataaaacttctgtcgatcaa
gacgcatggggctttgtcccgggcggcgataacccgtggaagaaatacgaaccggcgaaa
gcatggtccgcatccactgtgtacgtgaaaggtgatcgcgttgttgttgatgggcaggct
tatgaagcgctgttctggacgcaaagtgacaaccctgctctggtggcgaaccaaaacgcc
accggtagcaatagccgcccgtggaagccgttaggtaaggctcagagctatagcaacgaa
gagctgaataatgcgccgcagtttaatccagaaacgctttatgccagcgatacgctgatt
cgctttaacggtgtgaactacatttctcagagtaaagtgcagaaagtttctccttctgac
agcaacccgtggcgtgtttttgttgactggaccggaaccaaagagcgcgtaggtacgccg
aagaaagcgtggccgaaacacgtttatgcaccgtatgtcgactttacgctgaatacgatc
ccggatctggctgcgctggctaagaatcataacgtcaaccacttcacgctggcgtttgtg
gtgagtaaagatgcgaacacctgtctgccgacatggggtaccgcttacggtatgcagaat
tacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggcgatgtgatgctgtct
atcggtggtgctaacaacgctccgctggctgcttcctgtaagaacgtagacgatctgatg
cagcattattatgacatcgttgataacctgaacctcaaagtcctggacttcgatatcgaa
ggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtgaagaaagtg
caggataaatggaagtcagaaggcaaagatattgctatctggtacaccttgccaattctg
ccgactggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcgaaaggtgtt
gagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgtcagtctgca
aataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgccaacctgcat
tcacaattgaaaggcctccatcccaataagagcgatgcagaaattgacgctatgatgggt
accacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctctctgatgct
cgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatctggtcaatc
gcgcgcgacctgccgggcggcactaacctgtctccggaattccacggcctgactaaagaa
caggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaataa

DBGET integrated database retrieval system