KEGG   Escherichia coli UMNK88: UMNK88_4202Help
Entry
UMNK88_4202       CDS       T02001                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme GlgB
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00500  Starch and sucrose metabolism
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UMNK88_4202 (glgB)
Enzymes [BR:eun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     UMNK88_4202 (glgB)
Exosome [BR:eun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UMNK88_4202 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AEE58721
UniProt: A0A0E0U4L7
Structure
PDB: 

Jmol
Position
complement(4061886..4064072)
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHKTTAGLEVRALLPDATDVWVIEPKTGRKLAKL
ECLDSRGFFSGVIPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKYEMIDANGNLRLKSDPYAFEAQMRPETASLICGLPEKVVQTEERKKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEGNEIIVASNFTPV
PRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPPLAT
IWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaacgcgctaattgcaggccattttgcggat
cctttttccgtactgggaatgcataaaaccaccgcgggactggaagtccgtgccctttta
cccgacgctaccgatgtgtgggtgattgaaccgaaaaccgggcgcaaactcgcaaaactg
gagtgtctcgactcacggggattctttagcggcgtcattccgcgacgtaagaattttttc
cgctatcagttggctgttgtctggcatggtcagcaaaacctgattgatgatccttaccgt
tttggtccgctaatccaggaaatggatgcctggctattatctgaaggtactcacctgcgc
ccgtatgaaaccttaggcgcgcatgcagatactatggatggcgtcacaggtacgcgtttc
tctgtctgggctccaaacgcccgtcgggtctcggtggttgggcaattcaactactgggac
ggtcgccgtcacccgatgcgcctgcgtaaagagagcggcatctgggaactgtttatccct
ggggcgcataacggtcagctctataaatacgagatgattgatgccaatggcaacttgcgt
ctgaagtccgacccttatgcctttgaagcgcaaatgcgcccggaaaccgcgtctcttatt
tgcgggctgccggaaaaggttgtacagactgaagagcgcaaaaaagcgaatcagtttgat
gcgccaatctctatttatgaagttcacctgggttcctggcgtcgccacaccgacaacaat
ttctggttgagctaccgcgagctggccgatcaactggtgccttatgctaaatggatgggc
tttacccacctcgaactactgcccattaacgagcatcccttcgatggcagttggggttat
cagccaaccggcctgtatgcgccaacccgccgttttggtactcgcgacgacttccgttat
ttcattgatgccgcacacgcagctggtctgaacgtgattctcgactgggtgccaggccac
ttcccgactgatgactttgcgcttgccgaatttgatggcacgaacttgtatgaacacagc
gatccgcgtgaaggctatcatcaggactggaacacgctgatctacaactatggtcgccgt
gaagtcagtaacttcctcgtcggtaacgcgctttactggattgaacgttttggtattgat
gcgctgcgcgtcgatgcggtggcgtcaatgatttatcgcgactacagccgtaaagagggg
gagtggatcccgaacgaatttggcgggcgcgagaatcttgaagcgattgaattcttgcgt
aataccaaccgtattcttggtgagcaggtttccggtgcggtgacaatggctgaggagtct
accgatttccctggcgtttctcgtccgcaggatatgggcggtctgggcttctggtacaag
tggaacctcggctggatgcatgacaccctggactacatgaagctcgacccggtttatcgt
cagtatcatcacgataaactgaccttcgggattctctacaactacactgaaaacttcgtc
ctgccgttgtcgcatgatgaagtggtccacggtaaaaaatcgattctcgaccgcatgccg
ggcgacgcatggcagaaattcgcgaacctgcgcgcctactatggctggatgtgggcattc
ccgggcaagaaactactgttcatgggtaacgaatttgcccagggccgcgagtggaaccat
gacgccagcctcgactggcatctgttggaaggcggcgataactggcaccacggtgtccag
cgtctggtgcgcgatctgaacctcacctaccgccaccataaagcaatgcatgaactggat
tttgacccgtacggctttgaatggctggtggtggatgacaaagaacgctcggtgctgatc
tttgtgcgtcgcgataaagagggtaacgaaatcatcgttgccagtaactttacgccggta
ccgcgtcatgattatcgcttcggcataaaccagccgggcaaatggcgtgaaatcctcaat
accgattccatgcactatcacggcagtaatgcaggcaatggcggcacggtacacagcgat
gagattgccagccacggtcgtcagcattcactaagcctgacgctaccaccgctggccact
atctggctggttcgggaggcagaatga

DBGET integrated database retrieval system