KEGG   Escherichia coli UMNK88: UMNK88_4311Help
Entry
UMNK88_4311       CDS       T02001                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eun  Escherichia coli UMNK88
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eun00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4179269..4180345)
Genome map
AA seq 358 aa AA seqDB search
MLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFFALAANDR
AAFDNILDWTQNNLAQGSLKEGLPAWLWGKKENSKWEVLDSNSASDGDVWMAWSLLEAGR
LWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYLPPTLAQY
FTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYDAIRVYMW
VGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAAMLPFLQN
RDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQECANSH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggctgcctttagtgttcaggcagcctgtacctggcctgcctgggagcag
tttaaaaaggattacatcagtcaggaagggcgcgtcatcgaccccagcgacgcgcgcaaa
atcaccacctccgaagggcaaagttacggtatgttctttgccctggcggctaacgaccgt
gcagctttcgataatattctcgactggacgcagaacaatctcgctcagggttctttaaaa
gaaggtttgcccgcctggctgtggggcaagaaagagaacagtaagtgggaagtgctggac
agcaattcggcctccgatggtgatgtctggatggcctggtcattgctggaggcggggcgt
ttgtggaaagagcagcgttataccgacatcggcagcgcgttgctaaaacgtatcgcgcgg
gaggaagtggtgacggtgcctgggctgggttccatgttgttaccgggcaaagtgggtttt
gctgaggataacagctggcgttttaaccccagctacctgccgccgacgctggcgcagtat
ttcacccgctttggcgcgccgtggactacgctgcgcgaaaccaatcaacgtttattgctg
gaaaccgccccgaaaggcttttcgccagactgggtgcgctatgagaaagacaaaggctgg
cagctaaaagccgaaaaaacattgatcagcagctacgacgctatccgcgtttacatgtgg
gtaggcatgatgcctgacagcgatccgcaaaaagcgcggatgctcaaccggtttaaaccg
atggcgacattcactgagaaaaacggttatccgccggaaaaagtggatgtggctacgggg
aaagcgcagggtaaaggaccggtcggtttttctgccgccatgctgccttttttacaaaac
cgcgatgcgcaggccgttcagcgccagcgcgtggccgataactttcccggcagcgatgcc
tattacaactatgtgctgaccctgtttggacaaggctgggatcaacaccgtttccgcttc
tcgacaaaaggtgagttattacctgactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system