KEGG   Escherichia coli UMNK88: UMNK88_4311Help
Entry
UMNK88_4311       CDS       T02001                                 

Definition
(GenBank) endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eun  Escherichia coli UMNK88
Brite
Enzymes [BR:eun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     UMNK88_4311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4179269..4180345)
Genome map
AA seq 358 aa AA seqDB search
MLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFFALAANDR
AAFDNILDWTQNNLAQGSLKEGLPAWLWGKKENSKWEVLDSNSASDGDVWMAWSLLEAGR
LWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYLPPTLAQY
FTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYDAIRVYMW
VGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAAMLPFLQN
RDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQECANSH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggctgcctttagtgttcaggcagcctgtacctggcctgcctgggagcag
tttaaaaaggattacatcagtcaggaagggcgcgtcatcgaccccagcgacgcgcgcaaa
atcaccacctccgaagggcaaagttacggtatgttctttgccctggcggctaacgaccgt
gcagctttcgataatattctcgactggacgcagaacaatctcgctcagggttctttaaaa
gaaggtttgcccgcctggctgtggggcaagaaagagaacagtaagtgggaagtgctggac
agcaattcggcctccgatggtgatgtctggatggcctggtcattgctggaggcggggcgt
ttgtggaaagagcagcgttataccgacatcggcagcgcgttgctaaaacgtatcgcgcgg
gaggaagtggtgacggtgcctgggctgggttccatgttgttaccgggcaaagtgggtttt
gctgaggataacagctggcgttttaaccccagctacctgccgccgacgctggcgcagtat
ttcacccgctttggcgcgccgtggactacgctgcgcgaaaccaatcaacgtttattgctg
gaaaccgccccgaaaggcttttcgccagactgggtgcgctatgagaaagacaaaggctgg
cagctaaaagccgaaaaaacattgatcagcagctacgacgctatccgcgtttacatgtgg
gtaggcatgatgcctgacagcgatccgcaaaaagcgcggatgctcaaccggtttaaaccg
atggcgacattcactgagaaaaacggttatccgccggaaaaagtggatgtggctacgggg
aaagcgcagggtaaaggaccggtcggtttttctgccgccatgctgccttttttacaaaac
cgcgatgcgcaggccgttcagcgccagcgcgtggccgataactttcccggcagcgatgcc
tattacaactatgtgctgaccctgtttggacaaggctgggatcaacaccgtttccgcttc
tcgacaaaaggtgagttattacctgactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system