KEGG   Escherichia coli UMNK88: UMNK88_4930Help
Entry
UMNK88_4930       CDS       T02001                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase acsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00010  Glycolysis / Gluconeogenesis
eun00620  Pyruvate metabolism
eun00640  Propanoate metabolism
eun00680  Methane metabolism
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01120  Microbial metabolism in diverse environments
eun01130  Biosynthesis of antibiotics
eun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMNK88_4930 (acsA)
   00620 Pyruvate metabolism
    UMNK88_4930 (acsA)
   00640 Propanoate metabolism
    UMNK88_4930 (acsA)
  Energy metabolism
   00680 Methane metabolism
    UMNK88_4930 (acsA)
Enzymes [BR:eun01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     UMNK88_4930 (acsA)
Lipid biosynthesis proteins [BR:eun01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   UMNK88_4930 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEE59407
UniProt: A0A0E0U721
Position
complement(4809460..4811418)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgtacctgataccttctggggc
gaacagggaaaaattcttgactggatcaaaccttaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgcattggcgcggtgcattcg
gtgattttcggcggcttctcgccggaagccgttgccgggcgcattattgattccaactca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgcagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagcgagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctacacctccggttctaccggtaagccaaaaggtgtgctgcatactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggtgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttacttgctgtacggcccg
ctggcctgcggtgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggggataaagcgattgaaggcaccgaccgatcgtcgctg
cgcattctcggttccgtgggcgagccaatcaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaactggcggt
ttcatgatcacgccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggcgctacc
gaaggcagcctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgaacagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggataaccgggcgtgtggacgatgtgctg
aacgtctccggtcaccgtctgggaacggcggagattgagtcggcgctggtggcgcatccg
aagattgccgaagccgccgtagtaggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system