KEGG   Escherichia coli UMNK88: UMNK88_547Help
Entry
UMNK88_547        CDS       T02001                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eun  Escherichia coli UMNK88
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    UMNK88_547
Enzymes [BR:eun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UMNK88_547
   3.1.2  Thioester hydrolases
    3.1.2.-  
     UMNK88_547
Lipid biosynthesis proteins [BR:eun01004]
 Fatty acid synthase
  Component type
   UMNK88_547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(555140..555763)
Genome map
AA seq 207 aa AA seqDB search
MNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKT
SVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDV
KAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgttaacc
ttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccgggtat
cgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaaacg
tcggtagttaatgccagcatcagcggcgacacctcgcaacaaggactggcgcgccttccg
gctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgacggt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system