KEGG   Escherichia coli UMNK88: UMNK88_547Help
Entry
UMNK88_547        CDS       T02001                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eun  Escherichia coli UMNK88
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:eun01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(555140..555763)
Genome map
AA seq 207 aa AA seqDB search
MNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKT
SVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDV
KAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgttaacc
ttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccgggtat
cgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaaacg
tcggtagttaatgccagcatcagcggcgacacctcgcaacaaggactggcgcgccttccg
gctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgacggt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system