KEGG   Escherichia coli UMNK88: UMNK88_793Help
Entry
UMNK88_793        CDS       T02001                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase GpmA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00010  Glycolysis / Gluconeogenesis
eun00260  Glycine, serine and threonine metabolism
eun00680  Methane metabolism
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01120  Microbial metabolism in diverse environments
eun01130  Biosynthesis of antibiotics
eun01200  Carbon metabolism
eun01230  Biosynthesis of amino acids
Module
eun_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eun_M00002  Glycolysis, core module involving three-carbon compounds
eun_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMNK88_793
  Energy metabolism
   00680 Methane metabolism
    UMNK88_793
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMNK88_793
Enzymes [BR:eun01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     UMNK88_793
Membrane trafficking [BR:eun04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    UMNK88_793
Exosome [BR:eun04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   UMNK88_793
  Exosomal proteins of melanoma cells
   UMNK88_793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AEE55419
UniProt: A0A0E0TWC2
Structure
PDB: 

Jmol
Position
complement(812462..813214)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system