KEGG   Escherichia coli UMNK88: UMNK88_974Help
Entry
UMNK88_974        CDS       T02001                                 

Definition
macrolide-specific efflux protein MacA
Orthology
K13888  
macrolide-specific efflux protein MacA
Organism
eun  Escherichia coli UMNK88
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
981635..982750
Genome map
AA seq 371 aa AA seqDB search
MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALR
KVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEA
ELKLARVTYSRQQRLAQTQAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTN
LDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPG
QKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQL
TDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEV
VIGEAKPGAAQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcggaaaaccgtgaagaagcgttacgttattgcgctggtgatagtcatcgcc
ggactgattacgttatggagaattcttaacgcacccgtgccgacttatcagacactgatt
gtgcgccccggtgatttacagcaaagcgtgctggcgaccggaaagctggacgcgctgcgt
aaggttgacgtgggcgcgcaggtcagcggtcagttgaaaacgctgtcggtggcgattggc
gataaagtaaaaaaagaccagcttttaggggtcattgatcctgaacaggctgaaaaccag
atcaaggaggtcgaagcaacgctgatggagctacgcgcgcagcggcagcaggcggaagcg
gagctgaaactggcgcgggtgacgtattcccgtcagcaacgtctggcacaaacgcaggcg
gtttcacagcaggatctcgacaccgccgcgacggagatggctgtgaaacaggcgcaaatt
ggcaccattgacgcgcaaatcaagcgcaatcaggcttctctcgatacggctaaaaccaat
ctcgattacactcgcatcgttgccccgatggccggggaagtcacgcaaatcaccactctg
caaggccagacggtgattgccgcacaacaagcaccgaacattctgacgctggcagatatg
agcaccatgctggtaaaagcgcaggtttctgaagcggatgtaatccacctgaagccgggg
caaaaagcctggtttacggtgcttggcgatccactgacgcgctacgaggggcaaatcaag
gatgtactaccgacgccggaaaaggttaacgacgctattttctattacgcccgttttgaa
gtccccaaccccaatggtttgctgcggctggatatgactgcgcaagtgcatattcagctc
accgatgtgaaaaatgtgctgacgatccctctgtcggcgttaggcgatccggttggcgat
aatcgttataaagtcaaattgttgcgtaatggtgaaacacgcgagcgtgaagtgacgatt
ggcgcacgtaacgataccgatgttgagattgtcaaagggcttgaagcgggcgatgaagtg
gtgattggtgaggccaaaccaggagctgcacaatga

DBGET integrated database retrieval system