KEGG   Escherichia coli UMNK88: UMNK88_pEnt35Help
Entry
UMNK88_pEnt35     CDS       T02001                                 

Gene name
eltA
Definition
heal labile enterotoxin subunit LT-A
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
eun  Escherichia coli UMNK88
Brite
Enzymes [BR:eun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     UMNK88_pEnt35 (eltA)
Bacterial toxins [BR:eun02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    UMNK88_pEnt35 (eltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
pUMNK88_Ent:19429..20259
Genome map
AA seq 276 aa AA seqDB search
MALSFSGLSSCMIYKFSSMKNITFIFFILLASPLYANGDRLYRADSRPPDEIKRSGGLMP
RGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYY
IYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNRE
YRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQ
NLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttatctttttccggattgtcttcttgtatgatatataagttttcctcgatgaaa
aatataactttcattttttttattttattagcatcgccattatatgcaaatggcgacaga
ttataccgtgctgactctagacccccagatgaaataaaacgttccggaggtcttatgccc
agagggcataatgagtacttcgatagaggaactcaaatgaatattaatctttatgatcac
gcgagaggaacacaaaccggctttgtcagatatgatgacggatatgtttccacttctctt
agtttgagaagtgctcacttagcaggacagtctatattatcaggatattccacttactat
atatatgttatagcgacagcaccaaatatgtttaatgttaatgatgtattaggcgtatac
agccctcacccatatgaacaggaggtttctgcgttaggtggaataccatattctcagata
tatggatggtatcgtgttaattttggtgtgattgatgaacgattacatcgtaacagggaa
tatagagaccggtattacagaaatctgaatatagctccggcagaggatggttacagatta
gcaggtttcccaccggatcaccaagcttggagagaagaaccctggattcatcatgcacca
caaggttgtggaaattcatcaagaacaatcacaggtgatacttgtaatgaggagacccag
aatctgagcacaatatatctcagggaatatcaatcaaaagttaagaggcagatattttca
gactatcagtcagaggttgacatatataacagaattcgggatgaattatga

DBGET integrated database retrieval system