KEGG   Escherichia coli UMNK88: UMNK88_pK8847Help
Entry
UMNK88_pK8847     CDS       T02001                                 

Gene name
rafD
Definition
(GenBank) raffinose invertase RafD
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00052  Galactose metabolism
eun00500  Starch and sucrose metabolism
eun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    UMNK88_pK8847 (rafD)
   00500 Starch and sucrose metabolism
    UMNK88_pK8847 (rafD)
Enzymes [BR:eun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     UMNK88_pK8847 (rafD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AEE59831
UniProt: A0A0E0U7Q0
Position
pUMNK88_K88:complement(42126..43556)
Genome map
AA seq 476 aa AA seqDB search
MKQRLSLAQSALEKLSARRGNTWYPIFHLAPPAGWMNDPNGLIYFNGRYHAFFQHHPASA
YQGPMHWGHATSTDMLHWQHELVALAPGDKYDRDGCFSGSAVDDDGVLSLIYTGHICLED
RGNDSIIREVQCLATSHDGIRFEKQGCVLTPPEGIMHFRDPKVWHEDGSWWMVIGARDAS
DNGQVLLYRGTSLRDWHLEHVLAHSAAGESYMWECPDFFRCGNFHWLMFSPQGMNPSGYR
FRNLFQSGVLAGNWKPGSVFALKGVFEELDYGHDFYAPQSMLAEDGRRIIMAWMNMWDSP
VPTRSEAWAGCLTLPREVFERDGRLCQRPVREVESLRRKCQPLSPVRLHGVQLLTENVQA
AELLVTWHTVDSHAEHYGIRLGEGLRFYVDNQAGRLILWRYYPEEGLDGYRSVELPDTEY
LTLRIFLDRSSVEVFVNDGEATLSSRIYPQADSRQLSLYAAHGDAILTDGTLWMLT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtctttctttggcacagtctgcccttgaaaaacttagcgcacgtcgcggt
aatacttggtacccgatttttcatctggctccacctgccgggtggatgaatgatccaaat
ggcctgatttatttcaatggacgttaccatgcgttcttccagcatcatccagcaagcgca
tatcaggggccaatgcactgggggcatgccaccagtaccgacatgttgcactggcaacac
gagcttgtcgcgctggcacccggagataaatatgatcgtgatggctgtttttcagggagt
gccgtggatgatgatggcgtgctatcacttatttataccggccatatttgtctcgaagat
cgtggtaatgacagcattatccgtgaagtacagtgtctggctaccagtcatgatggtatt
cgctttgagaagcagggctgtgtgctgacacctcccgaaggtattatgcattttcgtgat
cccaaagtctggcacgaagacggctcctggtggatggtcattggtgcccgggacgcttct
gacaatgggcaagttctgttgtatcgcgggacatctttgcgggactggcatctggagcat
gttcttgctcattccgcagccggagaaagttatatgtgggaatgccccgatttcttcagg
tgtggtaattttcactggctgatgttctcaccacaggggatgaacccttccggttaccgg
ttccgtaacctttttcagagcggtgttttggcagggaactggaagcctggttctgtcttt
gcgctgaaaggggtatttgaagagctggattatggtcatgacttttatgccccacagtcc
atgctggctgaggacggcaggcgtatcattatggcatggatgaatatgtgggattcaccc
gtgcctacccgtagtgaagcctgggcaggatgtctgacgctgcccagagaggtttttgag
cgcgatggccggctgtgccagcgacctgtgcgtgaagttgaatctctgcgcagaaaatgc
cagccattatcccctgtaaggttacatggtgtgcaattactgaccgaaaatgtacaggcc
gcagaattactggtgacgtggcatacggttgacagtcacgcggagcactatggcatccgt
ctcggagaagggctgcggttctatgtggataatcaggccgggcgactgatactgtggcgt
tattaccctgaggaagggctggatggttaccgcagtgttgaacttcctgatacagaatat
ctgactcttcgtattttcctggatcgctcatctgttgaagtgtttgttaacgatggtgag
gcaaccttatcaagccgtatttatccgcaagcggactcgagacaattatcgttatatgcc
gctcatggcgatgcgatattaactgatggtactttatggatgctgacctga

DBGET integrated database retrieval system