KEGG   Escherichia coli UMNK88: UMNK88_pK8849Help
Entry
UMNK88_pK8849     CDS       T02001                                 

Gene name
rafA
Definition
alpha-D-galactosidase RafA
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
eun  Escherichia coli UMNK88
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    UMNK88_pK8849 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    UMNK88_pK8849 (rafA)
   00600 Sphingolipid metabolism
    UMNK88_pK8849 (rafA)
Enzymes [BR:eun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     UMNK88_pK8849 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pUMNK88_K88:complement(44896..47022)
Genome map
AA seq 708 aa AA seqDB search
MISKYCRLSSPRSDLIIKTHPHAEIIWWGSALKHFSPDDCASLERPVANGRLDIDTPLTL
IAENALGLFSSPGLEGHRNGLDASPVFYTVDVEHTENTLRLTSEDSVAGLRLVSELVMTP
SGILKVRHALTNLREGDWQINRFAITLPVAERAEEVMAFHGRWTREFQPHRVRLTHDAFV
LENRRGRTSHEHFPALIVGTPGFSEQQGEVWAVHLGWSGNHRMRCEAKTDGRRYVQAEAL
WMPGEKALRKNETLYTPWLYACHSADGLNGMSQQYHRFLRDEIIRFPEQKLRPVHLNTWE
GIYFNHNPDYIMQMAERAAALGVERFIIDDGWFKGRNDDRAALGDWYTDEQKYPNGLMPV
INHVKSLGMEFGIWVEPEMINPDSDLFRLHPDWILSMPGYSQPTGRYQYVLNLNIPEAFD
YIYKRFLWLLGEHPVDYVKWDMNRELVQAGHEGRAAADAQTRQFYRLLDLLRERFPHVEF
ESCASGGGRIDFEVLKRTHRFWASDNNDALERCTIQRGMSYFFPPEVMGAHIGHRRCHAT
FRQHSIAFRGLTALFGHMGLELDPVAADAKESDGYRRYALLYKEWRQLIHTGVLWRVDMP
DSSIQVQGVVSPDQSQALFMISQLAMPDYTLPGILRFPGLAAEVRYRLRVIDHPEIQLVG
EGGHTMRRLPAWMNQPLEASGEWLAKGGIQLPVLDPESAILIALERAV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaaagtactgcagactgagcagtcctcgctctgatttaattattaaaacccat
ccgcatgcagaaattatctggtggggctctgcactgaaacatttctcaccggatgactgt
gccagcctggaaagaccagttgcgaatggtcgtctggatattgatacgccactgacactg
atcgctgaaaatgcccttggactttttagttctccgggactggaaggacacagaaatgga
ctggatgcatctcctgttttttatacagttgacgtggaacataccgaaaacaccctgaga
cttaccagtgaagattcggtagccggcctgcgtctggtcagcgagctggtgatgacgcca
tcggggattctgaaagttcgtcatgcactgaccaacctcagagagggagactggcagata
aatcgtttcgcaatcactttacctgtagctgaacgtgcggaagaagtcatggcctttcac
ggacgctggactcgtgaatttcagccgcacagggtacgtcttactcatgatgcttttgtt
ctggaaaatcgcagagggcggacatctcatgagcattttccggcgctgattgtcggcaca
ccaggcttctcggaacaacagggagaagtgtgggctgtgcatctggggtggagtggaaat
caccgcatgagatgtgaggcaaaaactgatggcaggcgttacgtacaggctgaggctctg
tggatgccgggtgagaaggctctcaggaagaatgaaaccctgtacaccccgtggctatat
gcctgccactctgcggatggcctgaatggaatgagtcagcaataccatcgttttttgcgt
gatgaaattatccgtttccctgagcaaaaactccgccccgtacatctcaatacctgggaa
ggtatttatttcaatcacaatcctgattacatcatgcagatggctgagcgtgcagcagca
ctgggcgttgaacgtttcattattgatgatggctggtttaaaggacgtaacgatgaccgc
gcggctctgggcgactggtataccgatgaacagaaatacccgaacgggctgatgccggtt
attaatcatgtgaaatctctcggtatggagtttggtatatgggttgaaccagaaatgatt
aatccggattctgacctgtttcgtcttcatccggactggatattgtcaatgccaggatat
tctcagccaaccggaagatatcagtatgttcttaacctgaatattccggaggcctttgat
tatatttataaacgtttcttatggttactgggagaacatccggttgattatgtgaaatgg
gacatgaatcgtgagcttgtacaggcagggcatgaaggccgtgcggcagcagatgcacag
acccgtcagttctatcgattgcttgatctcctccgtgaacgttttccacatgttgagttt
gagtcctgtgcttccggtggggggcgtattgacttcgaagtcctgaaacgcacacaccgg
ttctgggcatctgacaataatgatgccctggagcgctgcaccatacaacgtggcatgagt
tactttttccctcctgaggtgatgggggcacatattggccatcgccgctgccatgcaact
ttccggcagcacagcatcgcttttcgtgggctgacggcattgttcggccatatggggctg
gagctggatccggtagccgcagatgcgaaggaatctgatggttatcgccggtatgccttg
ctctataaagaatggcgacaactgattcatacaggtgttctctggcgtgtggatatgccg
gattcttcgatacaggttcagggagtcgtcagccctgatcagtctcaggctctttttatg
atcagccagcttgcaatgccggattacaccttaccaggcatacttcgttttcccggactg
gcggcagaagtgcgttaccggcttcgggttattgatcacccggaaattcaactggttggt
gaaggtggtcataccatgcgcagattaccagcctggatgaaccagcccctcgaggccagt
ggtgaatggctggcaaagggagggattcagctccccgtactggatcctgagagcgcgatt
ttgatagcacttgaaagagctgtgtga

DBGET integrated database retrieval system