KEGG   Escherichia coli UMNK88: pUMNK88_84Help
Entry
pUMNK88_84        CDS       T02001                                 

Gene name
dsbC
Definition
putative protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eun  Escherichia coli UMNK88
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pUMNK88:69172..69879
Genome map
AA seq 235 aa AA seqDB search
MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVELPIKGVRAVQSDGQIMFLSE
NGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKSMGMDVDTLNTVSMGRGDKEVVVFV
DPRCAVCHQLMGDAKSLVDDYTFKFIVIPALGAESNRLAKNMYCAKDKTHALDALMNNTL
GSLPSKETCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKGRPKNLKSWLESAE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaaaattacttggggcgctgatggtgttcgggattattaccggcacggctcat
gcgtcatcgaaattggaaatcaccgatcccagagcggcgaagatagaggacattgtagag
ctacccatcaaaggggttcgagccgtccaaagtgatgggcagatcatgttcctctctgaa
aacggacgatttgttatttcaggacaaatctacgacctgtggagcaagaagcccctcaac
acgatgtcccaaatgagggatgtagcggagcgtatccacttcaagagcatgggcatggat
gtggacacgctgaacactgtgtcgatggggcgtggtgacaaagaggtggtggtctttgtt
gatcctaggtgcgcggtttgccatcagctcatgggtgatgccaaatcgctggtggatgat
tacacctttaaatttatcgtgattccagctctgggtgctgagtccaaccgcctggcaaaa
aacatgtactgcgcgaaagacaaaacccacgcgcttgatgcgctgatgaacaacaccctg
ggttcccttccttcaaaagaaacctgcgaccccggccaatacgaccaaacgctgctgaca
gctcatttcattgggattgagggcgttccgttcgttgttgctccggatggtcgtgtcagc
aaaggacgtccgaagaacctgaaatcatggttggagagtgctgaatga

DBGET integrated database retrieval system