KEGG   Eutrema salsugineum: EUTSA_v10000231mgHelp
Entry
EUTSA_v10000231mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
eus  Eutrema salsugineum
Brite
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     EUTSA_v10000231mg
    1.3.1.94  polyprenol reductase
     EUTSA_v10000231mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 337 aa AA seqDB search
MELGIVWLVRAAWIAAILPMVIASIPISKLRSFHELVMGFARRGKILQPSSSQKWTVPQR
FFAHFYVIGVAWTTLLLATTWMYAIKIAPLSPEKLQSSEIASHLTRGSKVFSFHESHLSS
YRFKVWRAVFLLVLMEIQVLRRLVESIYVFKYSPFARLHILGYLAGLFFYTAAPLSLCSS
IAPEIARFAGNQVAEFIAGESHTSAIDEFDLLLSIIPLMKLGSCQMIGGVVFLWGWSHQC
RCHAILGSLRESPSQEREYMIPHGDWFEMVSSPHYLAEIVLYAGLLVASGGTCVTIWLLF
GFVVWNLTLAAGETHRWYLRKFEDYPANRHAIFPFVY
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaattagggattgtgtggttggtgagagccgcttggatcgcagccatacttcccatg
gtgatcgcttcgatacccatttccaagcttagatcttttcatgaactcgttatgggtttc
gcaaggagaggcaagattcttcagccatcgtcatcacagaagtggacagttcctcagaga
ttctttgctcacttctatgtcatcggagtggcctggacgactcttctgctcgctaccact
tggatgtatgctatcaaaatcgctcctttgtcacctgagaagctccagtcttccgaaatc
gcaagccacttaaccagaggttccaaagttttctcctttcatgaatcacatttgagttct
tatcggttcaaagtgtggcgagcagtgtttctacttgttttgatggagatccaagtttta
agacgccttgtagagtcaatctatgtattcaagtatagcccttttgctcggctacacatt
cttggttatctcgctggattgtttttctatacagcagcgcctttatcactctgctctagt
atcgctccagagatagcaagattcgccggaaaccaagtagcagagttcattgcaggagaa
agccatacctcagccattgatgagtttgatttgttattgtctatcatccctctgatgaag
cttggatcgtgccagatgattggtggggtcgtttttctctggggatggtcacatcaatgt
cgttgtcacgcaattctcggatcgctccgggaaagtcctagccaagagagggagtacatg
atcccgcatggagattggtttgagatggtctcaagtccacattacttggcggaaatcgtt
ttgtacgcgggcttgttggttgcgagcggaggaacatgtgtaacgatttggttactcttt
ggtttcgtggtttggaatctgacattggcggctggagaaacgcaccggtggtatctaagg
aagtttgaggattatccggctaaccggcatgccattttcccttttgtgtactaa

DBGET integrated database retrieval system