KEGG   Eutrema salsugineum: EUTSA_v10003204mgHelp
Entry
EUTSA_v10003204mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
eus  Eutrema salsugineum
Pathway
eus00790  Folate biosynthesis
eus01100  Metabolic pathways
Module
eus_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EUTSA_v10003204mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EUTSA_v10003204mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoD
Motif
Other DBs
NCBI-GeneID: 18020659
NCBI-ProteinID: XP_006403396
UniProt: V4LM62
Position
Unknown
AA seq 464 aa AA seqDB search
MAASRVTSTIVMKLQHRLSFWWFSLLFTAAIATETPKVSPITRIAFGSCANQSAPQPIWD
AINKFDPQLFIWLGDNIYGDIRKPNRVFGKERTIGPWRNSPRFVPSSEEEMKLRYARAKA
NPGYSRLQRKARIVGTWDDHDYGLNDAGKEFDRKVINQKLMLDFLDEPLDSPRRKQAGVY
ASYMFGPPNRRVKVIVLDTRYHRDPIRSDGSILGDAQWRWLEEELRGPRSEITIVGSSVQ
VISNLSATTGPLFYMESWGRFPKERKRFFQLIEDTKRNGVVFISGDVHFGEITRYDCAVG
YPLYDVTSSGLVQSVEKVFPRPLRFIVRLLFWYTPSTMRVINENCKYRSCTYGQQNFGAI
SIDWNANPATIRLEVRDVNGLTALSTNVSLSELQPRGSKPLTDSTRKGKSQPYCTLEVEL
PGTTRYRLAVLIYFTIAVLAMALVGLIIGAVLTITACVYKCKLD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctagggttacttccactatcgtgatgaagcttcaacatcgcctatccttc
tggtggttttcgttgctttttacggcggcgatagcgaccgaaacaccaaaagtttctccg
atcactcgtatcgctttcggatcatgcgctaatcaaagcgctccacagccgatttgggat
gcgataaacaagtttgatccacaattgttcatttggctgggtgataacatatatggagat
ataagaaaaccgaatagagtgtttgggaaagagagaaccattgggccatggaggaattct
ccgaggtttgtgccttcttcagaggaagaaatgaaattaagatacgcaagagccaaggct
aatcctggttactctcgtctccagagaaaagctagaattgttggtacttgggatgaccat
gattacgggttgaatgatgctggaaaagagtttgatcgtaaagtcattaaccaaaaactc
atgcttgatttcttggatgagcctcttgatagcccaaggagaaagcaagctggagtttat
gcgtcttacatgtttggtccacctaaccggagagtcaaggttatagttttagataccaga
tatcatagagaccctatccgaagtgacgggagtatcttgggtgatgcgcagtggagatgg
ctcgaagaagagttgagaggtccgcgcagcgaaattactatcgtaggatcgtctgttcag
gtaatatcaaatctttcggcaaccactggaccgctcttttatatggaatcatggggccgt
tttccaaaagaaaggaaacgttttttccaactgatagaagataccaagagaaatggagtt
gtattcatcagtggagatgttcattttggagagattacgagatacgattgtgctgttggg
tacccattatatgatgtcacctccagtggccttgtacaatctgttgagaaagtttttcct
cgtcccttgcgtttcatcgttaggcttctgttttggtatactccaagcacgatgagagtt
atcaatgaaaactgcaaatatagatcatgcacatatggacaacaaaattttggagcaata
tcgatagattggaatgcaaatccggcaactataaggcttgaggtcagagatgttaacgga
ctcacagcactaagcacaaatgtttcactatccgaacttcaaccacgaggctcaaagccc
ttgacagattcaaccaggaagggaaagtcccaaccatattgcaccctcgaagttgaatta
ccaggaacaaccagataccgattggcagttctcatctacttcaccattgctgtcttggca
atggcgttagtaggactgatcattggagctgtactgactattacagcatgcgtttataaa
tgcaagctcgactga

DBGET integrated database retrieval system