KEGG   Eutrema salsugineum: EUTSA_v10003227mgHelp
Entry
EUTSA_v10003227mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K13082  bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
eus  Eutrema salsugineum
Pathway
eus00941  Flavonoid biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Module
eus_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    EUTSA_v10003227mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     EUTSA_v10003227mg
    1.1.1.234  flavanone 4-reductase
     EUTSA_v10003227mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 NmrA adh_short Polysacc_synt_2 KR
Motif
Other DBs
NCBI-GeneID: 18020608
NCBI-ProteinID: XP_006403345
UniProt: V4LY30
Position
Unknown
AA seq 382 aa AA seqDB search
MVSHKETVCVTGASGFIGSWLVMRLLERGYFVRGTVRDPGNLKKVQHLLDLPNAKTQLTL
WKADLSDEGSYDEAINGCDGIFHVATPMDFESTDPENEVIKPTVNGVLGIMKACVKAKTV
RRIVFTSSAGTVNVEEHMKDVYDESDWSDLNFIMSKKMTGWMYFLSKMLAEKAAWDYAKE
NGIDFISIIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIF
LFEEAVAKGRYICSSHDATILSISGFLRKKYPEYNVPATFEGVDENLKSIMFSSKKLIDM
GFSFKYSLEEMLVESIETCREKGFLPVSFPKPSKSEEKVPTSDDKSEHKIGAGLTDGMMP
CTEPVVSREKTDACMQAQQMCA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcacaaagagaccgtgtgcgtgaccggtgcgtcaggattcatcggttcatgg
ctagtgatgcgattactcgaacgcggttactttgtccgtggcactgttcgcgatcccggg
aatttgaaaaaagtgcaacatcttcttgatttgccaaacgccaagacacaactcactcta
tggaaagccgatttatctgacgaaggaagctacgacgaagccataaacggatgcgatggc
attttccacgtagcaactcccatggattttgaatcaacggatcctgagaacgaagtgata
aaaccaacggttaatggagtgttggggataatgaaagcatgtgttaaggcaaagacagta
cgaagaatcgtctttacctcgtctgccggaacggttaatgttgaggaacatatgaaagat
gtctatgatgaaagcgactggagtgatcttaactttatcatgtccaagaagatgacagga
tggatgtatttcttgtcgaaaatgttagccgagaaagcagcgtgggattacgcgaaggaa
aacggaatagatttcattagcatcattccgactttggtgatcggtccgtttataacaaca
tctatgccgcctagcctcattaccgcgctctctcctatcactcggaatgaggcacattac
tcgatcataagacaaggacagtacgtgcatttggacgacttatgcaatgcgcatatattc
ttgtttgaagaagcagttgccaagggacgttatatttgttcctctcacgatgccacaatt
ctcagtatctctggatttcttaggaaaaaatacccggaatataacgtgcctgcaacgttt
gaaggtgtggatgagaatctgaagagcattatgttcagttcgaagaagctgattgatatg
ggattcagcttcaagtatagtctcgaggagatgttggtcgaatcgattgagacatgtcgt
gaaaagggttttcttcctgtttcttttccaaagccatcgaaatctgaggaaaaagttcca
actagtgatgacaagagtgagcacaaaatcggagctggtttaaccgatggtatgatgcct
tgtacagaaccggtggtatcccgcgaaaaaaccgatgcttgtatgcaggcacagcagatg
tgtgcttag

DBGET integrated database retrieval system