KEGG   Eutrema salsugineum: EUTSA_v10007718mgHelp
Entry
EUTSA_v10007718mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
eus  Eutrema salsugineum
Pathway
eus00561  Glycerolipid metabolism
eus01100  Metabolic pathways
Module
eus_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EUTSA_v10007718mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     EUTSA_v10007718mg
Peptidases [BR:eus01002]
 Serine Peptidases
  Family S33
   EUTSA_v10007718mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 LIDHydrolase FSH1 Peptidase_S15 AXE1
Motif
Other DBs
NCBI-GeneID: 18993074
NCBI-ProteinID: XP_006416612
UniProt: V4KB76
Position
Unknown
AA seq 423 aa AA seqDB search
MIREKPKFGIFFSTQKSRIPPLNFREAIKIAFGFSLFMVWSSGGTIVIASGNSIPRLPLK
KPFGFYVNGIRNHLPISVTAIRRRSSMAVGAMPMRSKSSPRRRNIVCGVSPSPTTVVDEE
VAVRRGLAMRRVLEDDGGDGIYVRDFSLFPTKRGDTLFTQSWTPVGSVKNRGFVVLLHGL
NEHSGRYSDFAKQLNVNGFKVYGLDWIGHGGSDGLHAYVPSLNYAVADLKSFLEKVIAEN
PGLPCFCIGHSTGGAIILKAMLDPKIEARVSGIVLTSPAVGVQPSHPIFGVIAPVLAFLI
PRYQLSAAKKKIMPVSRDPEAVVAKYSDPLVYTGFIRARTGNEILRLAAHLLQNLKRIKV
PFLVLHGTADTVTDPKGTQKLYNEASSSDKSIKLFDGLLHDLLFEPERGIIAGVILDWLN
RRV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaaaacctaaatttgggattttcttctccactcaaaagtctcgcattcca
ccccttaatttcagagaggcgataaaaatcgcctttggattttctttgtttatggtctgg
tcaagtggaggaacgattgttatagctagtggaaactcaatcccgaggttacccctcaaa
aaacctttcggattttatgtaaatgggattcgaaatcatcttccgattagtgtcacagct
attagaagacgatcatcaatggcggtgggcgcgatgccgatgagatcaaaatcatcaccg
aggaggaggaacatcgtctgcggcgtttccccatcgccgacgacggtggttgatgaagaa
gtggccgttagacggggtttagcaatgaggcgggttttggaggatgacggtggcgatgga
atctacgtcagagatttctctctcttcccgacaaagagaggagacacgttgttcactcag
tcatggacacctgttggctccgttaagaacaggggctttgttgttctgctacatggtctg
aacgaacacagtggcaggtatagtgattttgcaaagcagctaaatgttaatggattcaag
gtctatggactagactggatcggtcatggtggaagcgatggacttcatgcttatgttcct
tctcttaattatgctgttgctgatttgaaatcgtttcttgagaaggtaatagcagaaaac
ccgggattgccctgtttctgcattggccactcaacaggaggagccatcatcttaaaggct
atgctagatccaaagatcgaagctcgagtttcagggattgtgttaacttcacctgcagtt
ggagtccaaccatctcatcctatttttggcgtaattgcaccggtccttgcgttcctcatt
ccgaggtatcagttaagtgctgcaaagaagaaaataatgccggtttctcgtgacccggaa
gctgtcgtggctaaatactctgacccgttagtctacaccgggtttatccgagcaagaacc
ggtaacgagatccttagacttgctgctcatctgctgcagaatctgaaaagaatcaaggtc
ccgtttctcgtgctgcacggcacagccgatacagttactgatcctaaagggactcagaag
ctttacaacgaggcttcctcgtccgacaagtcgatcaagctgttcgatgggttgctgcat
gatctgctctttgaaccggaacggggaattatcgctggagtcatattggattggctaaac
cggcgggtttaa

DBGET integrated database retrieval system