KEGG   Eutrema salsugineum: EUTSA_v10007918mgHelp
Entry
EUTSA_v10007918mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eus  Eutrema salsugineum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EUTSA_v10007918mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EUTSA_v10007918mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 382 aa AA seqDB search
MMMKGIALSQSNNFHPNIEFNRAKLPINTVNPIPSRFSRPISRRSLRVLSLSVDPSVNRK
AKLTPEAHAPPLVVVGSANADIYVEIDRLPKEGETISAKTGQTLAGGKGANQAACGAKLL
YPTYFVGRLGEDAHGKLIADALGDGSDGSGVHLDYVRSVTDEPTGHAVVMLQSDGQNSII
IVGGANMRGWPDKMSDDDLEIVRNAGVVLLQREIPDSINIQVAKAAKKADVPVILDVGGM
DTPIPNELLDSVDILSPNETELSRLTGMPTETFEQISEAVAKCHKLGVKQVLVKLGSKGS
ALFIEGEKPIQQSIIPAAQVVDTTGAGDTFTAAFAVAMVESKSREECLRFAAAAASLCVQ
VKGAIPSMPNRTSVVKLLQSSV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaaagggattgcactttctcaatcgaataatttccatccaaacatcgaattc
aatcgagcgaagcttccgatcaacactgtgaatccaatcccatctcgattttcccgccct
atttcccgaagatccctccgtgttctctctctctccgtcgacccatcggtaaatcggaaa
gctaaattgaccccggaagcccacgcgccgccgctggtggttgtgggatctgcgaacgcc
gacatctacgtggagatcgatagattgcccaaggaaggggaaacgatttcggccaagaca
gggcaaaccctcgccggcggaaaaggcgcgaatcaggcggcgtgtggcgccaagctgctt
tatccgacctacttcgtgggtcgtttgggagaggacgcgcacgggaagctgatcgcagat
gcattgggcgatggatccgatgggtctggagtccacttggattacgtgaggtcggtgacg
gacgagccgacgggacacgcggtggtgatgctgcaatcggacggtcagaactcgatcatt
atcgtcggtggggctaatatgagaggctggcctgataagatgagcgatgatgaccttgag
atcgtgaggaatgctggtgttgtgctgctgcaaagagaaatcccagattccatcaatatc
caagtcgctaaggctgcgaagaaagcagatgttccggttatcctcgatgtgggaggaatg
gatacgccaatccctaatgagcttttggattccgttgacatattgagcccgaatgagact
gagctcagtcgtttgaccggaatgccaactgagacttttgaacagataagtgaggctgtt
gcaaagtgccataagttgggagtaaagcaagtcctagtgaaactcgggtctaaaggatct
gcactattcatagaaggagaaaaaccgatccagcagtcaataataccggctgcacaagta
gtcgatactacaggagccggcgatacattcacagcagcgtttgcagtggccatggtagag
agcaagtctcgtgaagaatgtttgagatttgctgctgcagctgcctctctgtgtgtccaa
gtaaagggtgcaattccaagcatgcccaatcgaacatctgtcgtgaagctccttcaatct
agtgtctaa

DBGET integrated database retrieval system