KEGG   Eutrema salsugineum: EUTSA_v10007918mgHelp
Entry
EUTSA_v10007918mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
eus  Eutrema salsugineum
Pathway
eus00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EUTSA_v10007918mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EUTSA_v10007918mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Kelch_2 SNN_cytoplasm
Motif
Other DBs
NCBI-GeneID: 18993176
NCBI-ProteinID: XP_006416733
UniProt: V4MTF9
Position
Unknown
AA seq 382 aa AA seqDB search
MMMKGIALSQSNNFHPNIEFNRAKLPINTVNPIPSRFSRPISRRSLRVLSLSVDPSVNRK
AKLTPEAHAPPLVVVGSANADIYVEIDRLPKEGETISAKTGQTLAGGKGANQAACGAKLL
YPTYFVGRLGEDAHGKLIADALGDGSDGSGVHLDYVRSVTDEPTGHAVVMLQSDGQNSII
IVGGANMRGWPDKMSDDDLEIVRNAGVVLLQREIPDSINIQVAKAAKKADVPVILDVGGM
DTPIPNELLDSVDILSPNETELSRLTGMPTETFEQISEAVAKCHKLGVKQVLVKLGSKGS
ALFIEGEKPIQQSIIPAAQVVDTTGAGDTFTAAFAVAMVESKSREECLRFAAAAASLCVQ
VKGAIPSMPNRTSVVKLLQSSV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaaagggattgcactttctcaatcgaataatttccatccaaacatcgaattc
aatcgagcgaagcttccgatcaacactgtgaatccaatcccatctcgattttcccgccct
atttcccgaagatccctccgtgttctctctctctccgtcgacccatcggtaaatcggaaa
gctaaattgaccccggaagcccacgcgccgccgctggtggttgtgggatctgcgaacgcc
gacatctacgtggagatcgatagattgcccaaggaaggggaaacgatttcggccaagaca
gggcaaaccctcgccggcggaaaaggcgcgaatcaggcggcgtgtggcgccaagctgctt
tatccgacctacttcgtgggtcgtttgggagaggacgcgcacgggaagctgatcgcagat
gcattgggcgatggatccgatgggtctggagtccacttggattacgtgaggtcggtgacg
gacgagccgacgggacacgcggtggtgatgctgcaatcggacggtcagaactcgatcatt
atcgtcggtggggctaatatgagaggctggcctgataagatgagcgatgatgaccttgag
atcgtgaggaatgctggtgttgtgctgctgcaaagagaaatcccagattccatcaatatc
caagtcgctaaggctgcgaagaaagcagatgttccggttatcctcgatgtgggaggaatg
gatacgccaatccctaatgagcttttggattccgttgacatattgagcccgaatgagact
gagctcagtcgtttgaccggaatgccaactgagacttttgaacagataagtgaggctgtt
gcaaagtgccataagttgggagtaaagcaagtcctagtgaaactcgggtctaaaggatct
gcactattcatagaaggagaaaaaccgatccagcagtcaataataccggctgcacaagta
gtcgatactacaggagccggcgatacattcacagcagcgtttgcagtggccatggtagag
agcaagtctcgtgaagaatgtttgagatttgctgctgcagctgcctctctgtgtgtccaa
gtaaagggtgcaattccaagcatgcccaatcgaacatctgtcgtgaagctccttcaatct
agtgtctaa

DBGET integrated database retrieval system