KEGG   Eutrema salsugineum: EUTSA_v10008064mgHelp
Entry
EUTSA_v10008064mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
eus  Eutrema salsugineum
Pathway
eus00564  Glycerophospholipid metabolism
eus01100  Metabolic pathways
Module
eus_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EUTSA_v10008064mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     EUTSA_v10008064mg
    2.7.1.82  ethanolamine kinase
     EUTSA_v10008064mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Haspin_kinase Pkinase Choline_kin_N
Motif
Other DBs
NCBI-GeneID: 18991655
NCBI-ProteinID: XP_006415036
UniProt: V4KPY6
Position
Unknown
AA seq 351 aa AA seqDB search
MGVGVLGLIPISSPDSLKKVLQTLSGKWGDVVEDLESLQVRPMKGAMTNEVFMVNWPTKE
NTFHHRKLLVRVYGQGVDLFFDRKDEIRTFEVVSRYGHGPRLLGRFAGGRIEEFINARTL
SAKDLRDPEVSALVAAKLREFHGINIPGERNVLLWDSMRNWLGQAKSLCTPEDAAEFGLD
NMEAEIDLLEHELQYKQEEIGFCHNDLQYGNIMIDENTNAITIIDYEYASYNPVAYDIAN
HFCEMAANYHSDTPHVLDYTLYPGEEERRRFIHNYLSSSGEEPKEEDIKQLLDDAEKYTL
ASHLFWGLWGIISGYVNKIEFDYAEYSRQRFKQYWLRKPELLPSFSSQMFE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaggagtgttgggtttaatcccgatttcatcaccagacagtctaaagaaagta
cttcaaacactgtcgggaaaatggggagacgtagtggaagatctcgagagtctacaagtg
agacccatgaaaggtgcaatgaccaacgaagttttcatggtgaattggcccacaaaggaa
aacacttttcaccataggaagcttctcgttcgagtttatggccaaggggttgatctgttc
ttcgacaggaaagacgagattcgtacgttcgaagttgtctctcgatatggtcacggtcct
agactccttggccggttcgctggcggtcgaatcgaggagtttatcaatgcccggacttta
tcggctaaggatcttcgtgacccggaagtatctgctcttgttgcggctaagctaagagaa
tttcacggtataaacattcctggtgaaagaaatgtgctcctttgggatagtatgaggaat
tggctaggacaagccaagagtttgtgtacacctgaagatgcagcagagtttggtctagac
aacatggaagccgagattgacttgctggaacatgagctgcagtataagcaggaggagatt
gggttttgtcacaatgatttgcagtacggtaacatcatgattgatgaaaacaccaatgcc
attactatcattgactacgagtatgctagttataacccagttgcatacgacatagcaaat
cacttctgtgaaatggcggcaaactaccattctgacactccccatgtcttggactacact
ctatacccaggagaagaggaacggaggagattcattcataactatctcagctcttcaggt
gaagaaccaaaggaagaagacataaaacagctcttggatgatgctgagaagtacacattg
gcaagtcatctcttctggggcttatggggaatcatctctggatatgtgaacaagatcgag
ttcgattacgctgagtactcaagacagagattcaaacagtactggcttcgaaaacccgag
ctcttgccttccttctcgtctcagatgtttgaataa

DBGET integrated database retrieval system