KEGG   Eutrema salsugineum: EUTSA_v10008299mgHelp
Entry
EUTSA_v10008299mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 18994262
NCBI-ProteinID: XP_006417959
UniProt: V4L210
Position
Unknown
AA seq 304 aa AA seqDB search
MSMSSSEEENHRKSVEDKAEMGRRKRAIWERKWKRLDIVKASASLFVHFLCLLAPFNFTW
PALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYLFAYCGLLAIQGDPIDWVSTHR
YHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTVL
YHILAFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHIWGSRTWKTNDTSRNVWW
LSVFSFGESWHNNHHAFESSARQGLEWWQVDISWYIVRFLEIIGLATDVKLPSESQRRRM
ALVR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgtcatcgtcggaggaggagaatcaccggaaatcagtggaggacaaggctgag
atggggaggagaaaaagggcaatttgggaaagaaagtggaagagactagacattgtgaaa
gcttctgcttctctctttgtgcatttcctctgtcttttagctcctttcaattttacttgg
ccagctttacgggtggcactcattgtatatacggtgggtgggctcggtatcaccgtctct
taccaccgtaacttggctcaccggagctttaaagtccctaaatggctcgagtatttattt
gcttattgcggccttcttgccattcagggagatccgattgattgggtgagcacacatcga
taccatcaccagtttacagattcggatagggacccacatagtcctaatgaaggtttttgg
ttcagccatctcctatggctatttgatacaggttatcttgtagaaaagtgtgggagaagg
acaaatgtggaggatttaaagaggcaatggtactataagttccttcaaagaacggtcctt
taccacattctagcatttggtttcctcctctattactttggtggtttgtcttttcttact
tggggaatgggtattggggtagcaatggagcatcatgtgacttgcctcatcaactctctt
tgccatatttggggaagccgaacttggaagaccaatgacacctctcgtaacgtttggtgg
ctgtcggtattctcatttggagagagctggcacaacaatcaccacgcgttcgagtcgtcg
gcgagacaaggcttggaatggtggcaagtcgacatctcttggtacatcgtccgctttctc
gagatcatcggtttggctactgacgtgaagctgccttcagagagtcaacgacgtcgtatg
gcattggttcgttga

DBGET integrated database retrieval system