KEGG   Eutrema salsugineum: EUTSA_v10008320mgHelp
Entry
EUTSA_v10008320mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
eus  Eutrema salsugineum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    EUTSA_v10008320mg
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EUTSA_v10008320mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     EUTSA_v10008320mg
Lipid biosynthesis proteins [BR:eus01004]
 Desaturase
  First
   EUTSA_v10008320mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 299 aa AA seqDB search
MCDPTRDDGFSQTGVLPDEKRPYFHRKWPLVDVIRMLIVLIVHFLCLLAPFNYNWEALRF
GLVLYVVTIFSITFSYHRNLSHRSFKIPKWLEYPFAYTAVFALQGDPMDWVSIHRFHHQF
TDLKRDPHSPKEGFWFSHIFWMFDTLYIKYKCGGRDNVKDLKEQWFYRFLRRTIAVHIVM
YWTFLYLYGGLPYLTCGGGVGGVIGYHVTFLVNSACHVWGSRSWNTKDTSRNVWWLSIFT
MGESWHNNHHAFESSARQGLEWWELDITWYLIRLLELVGLATDVKLPSEFQKRKLAIAR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatcccactagagacgatggctttagccaaaccggtgtattgcctgacgaaaaa
aggccatactttcatagaaagtggccgttggtcgatgtgataagaatgttaatcgttttg
attgtgcactttttgtgtctcttggccccgttcaactacaattgggaagccttacggttc
ggtttggttctatatgtggtgactatattcagcatcacattctcataccataggaacttg
tctcaccggagtttcaaaatccctaaatggctcgaatatccttttgcttatactgctgtt
ttcgctcttcagggtgatccaatggactgggtaagcatacataggttccatcaccagttc
acagatttgaaacgcgacccacacagccctaaagaaggattctggttcagccatatcttc
tggatgtttgacaccctttatatcaaatataagtgtggaggacgtgacaacgtgaaggac
ttgaaggaacaatggttctataggtttctacgaaggacgattgctgtccacattgtaatg
tattggaccttcctctatctctatggtggtttaccttaccttacgtgcggcgggggcgtt
ggaggcgtgatcggataccacgtgacatttctcgtaaactcagcatgccatgtttggggt
tcgagatcgtggaatactaaagacacatcacgtaacgtttggtggctaagcatatttacg
atgggagagagttggcacaacaatcatcacgcctttgagtcatcggcgaggcaaggattg
gagtggtgggaactagacatcacttggtacctcattcgactacttgaacttgtcggatta
gccaccgatgtgaaattgccctcagaattccaaaaacggaagctggctatcgctcgttga

DBGET integrated database retrieval system