KEGG   Eutrema salsugineum: EUTSA_v10008320mgHelp
Entry
EUTSA_v10008320mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase ABC2_membrane
Motif
Other DBs
NCBI-GeneID: 18994236
NCBI-ProteinID: XP_006417931
UniProt: V4KY67
Position
Unknown
AA seq 299 aa AA seqDB search
MCDPTRDDGFSQTGVLPDEKRPYFHRKWPLVDVIRMLIVLIVHFLCLLAPFNYNWEALRF
GLVLYVVTIFSITFSYHRNLSHRSFKIPKWLEYPFAYTAVFALQGDPMDWVSIHRFHHQF
TDLKRDPHSPKEGFWFSHIFWMFDTLYIKYKCGGRDNVKDLKEQWFYRFLRRTIAVHIVM
YWTFLYLYGGLPYLTCGGGVGGVIGYHVTFLVNSACHVWGSRSWNTKDTSRNVWWLSIFT
MGESWHNNHHAFESSARQGLEWWELDITWYLIRLLELVGLATDVKLPSEFQKRKLAIAR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatcccactagagacgatggctttagccaaaccggtgtattgcctgacgaaaaa
aggccatactttcatagaaagtggccgttggtcgatgtgataagaatgttaatcgttttg
attgtgcactttttgtgtctcttggccccgttcaactacaattgggaagccttacggttc
ggtttggttctatatgtggtgactatattcagcatcacattctcataccataggaacttg
tctcaccggagtttcaaaatccctaaatggctcgaatatccttttgcttatactgctgtt
ttcgctcttcagggtgatccaatggactgggtaagcatacataggttccatcaccagttc
acagatttgaaacgcgacccacacagccctaaagaaggattctggttcagccatatcttc
tggatgtttgacaccctttatatcaaatataagtgtggaggacgtgacaacgtgaaggac
ttgaaggaacaatggttctataggtttctacgaaggacgattgctgtccacattgtaatg
tattggaccttcctctatctctatggtggtttaccttaccttacgtgcggcgggggcgtt
ggaggcgtgatcggataccacgtgacatttctcgtaaactcagcatgccatgtttggggt
tcgagatcgtggaatactaaagacacatcacgtaacgtttggtggctaagcatatttacg
atgggagagagttggcacaacaatcatcacgcctttgagtcatcggcgaggcaaggattg
gagtggtgggaactagacatcacttggtacctcattcgactacttgaacttgtcggatta
gccaccgatgtgaaattgccctcagaattccaaaaacggaagctggctatcgctcgttga

DBGET integrated database retrieval system