KEGG   Eutrema salsugineum: EUTSA_v10010247mgHelp
Entry
EUTSA_v10010247mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
eus  Eutrema salsugineum
Brite
Enzymes [BR:eus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EUTSA_v10010247mg
Transcription machinery [BR:eus03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     EUTSA_v10010247mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 568 aa AA seqDB search
MESHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSTSF
PPSSFSADTRDGALASNDDLESISARGADTDSDPEESEDAVVDDDEDEFAPEPDQDSSMR
TFTAARLESSSGVNGSSRNVKIKTESSTVKLESSDGGKDGRPSVVGTGVSGTVGGNSISG
LVPKDESAKILTENLQTSGAYIAREEALKAEEKAGRLKFVCYSNDCVDEHMMCLVGLKNI
FARQLPNMPKEYIVRLLMDRKHKSVMVLRSNLVVGGITYRPYHSQRFGEIAFCAITADEQ
VKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDY
DGGLLMECKIDPKLPYTDLSTMIRQQRKAIDERIRELSNCQNVYQVVEFQKKEAGSPKRI
KVEDIPGLRDAGWTPDQWGHTRYKLFNSSADSGTKQKQLTALMRALLKTMHDHADAWPFK
EPVDSRDVPDYYDIIKDPIDLKTIAKRVESEQYYYVTLDMFVADARRMFNNCRTYNSPDT
IYYKCATRLETHFHSKLQAALQSGAKSQ
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcactcttctcacctcaacgccgccaatcgttcgcgtagctctcagactcca
tctccttcacattccgcctccgcctccgtcacttcttccctccacaaacgcaagctcgcc
gccaccactgctgcgaatgcggccgcgtctgaggaccatgcccctccttctacttctttc
cctccctcctccttctccgccgatacgcgcgacggagccttagcctccaacgatgacctc
gagagcatctccgcgcgcggcgccgataccgactcagaccctgaggagtcagaggatgca
gtcgtggacgatgacgaggacgaatttgctcccgagccggaccaggactcttccatgcgc
acattcaccgccgctagactcgagtccagctcaggagtcaacggttcgagtcgcaacgtc
aagattaagacggagagctccacggtgaagcttgagagctctgatggcggaaaggatggt
agaccatctgtggtcgggactggtgtgagtggaaccgttggagggaactcaatatcgggg
ctggtgcctaaggatgagtctgctaagatattgacagagaatttgcagactagcggggct
tacattgcgagagaagaggctttgaaggcagaggaaaaagctggacggctcaaatttgtc
tgttactcaaatgattgcgttgatgagcatatgatgtgcttggttgggttgaagaacata
tttgcaagacagttgcctaatatgcccaaggagtacattgttcgccttctgatggatagg
aaacataaatctgttatggtcctaagaagcaatctagttgtaggtggtatcacatatcgt
ccatatcacagtcagaggtttggggaaatagcattttgtgcaatcactgcagatgaacaa
gtaaagggttatggtaccagattgatgaaccacttgaaacaacatgcacgtgatgttgat
ggattgacgcattttcttacttatgctgacaataatgccgttggttatttcgtcaagcag
ggttttacgaaagagatttacttggagaaggatgtatggcatgggttcattaaagactat
gatggtggcctccttatggaatgcaaaattgatccgaagcttccatatacagatttgtca
actatgattcgccagcaacgaaaggcaattgatgaaaggataagagagttatcgaactgt
cagaatgtgtatcaagtagttgaatttcaaaagaaagaagctggaagtcctaaaagaatc
aaagttgaggatatacctggcttaagggacgctggttggaccccagatcagtgggggcac
acacgttacaaattgttcaatagctctgcggatagtgggacaaagcaaaagcagttgacc
gcacttatgcgcgcgcttttgaagacaatgcatgaccatgctgatgcttggcctttcaaa
gagccagttgattcccgcgatgtccctgattactatgacattataaaagatcccattgat
ctgaagacaattgcaaagagagtagagtcggaacagtactactacgtgacgcttgatatg
tttgtcgctgatgctagacggatgtttaacaattgtagaacttacaactccccggatacc
atttattacaaatgtgctaccaggttggaaacacacttccatagcaaacttcaagcagct
ctacaatctggtgctaaatctcaataa

DBGET integrated database retrieval system