KEGG   Eutrema salsugineum: EUTSA_v10011498mgHelp
Entry
EUTSA_v10011498mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
eus  Eutrema salsugineum
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    EUTSA_v10011498mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     EUTSA_v10011498mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 432 aa AA seqDB search
MAETVHSPIVTYASMLSLLAFCPPFVMLLWYTMVHQDGSVIQTSGFLWQNGFQGLINIWP
RPTAIAWKIIFCYGAFEATLQLLLPGKRVEGPISPTGNRPVYKANGLASYFVTLATYLGL
WWFGIFNPAIVYDHLGEIFSALIFGSLVFCVLLYVKGHVAPSSSDSGSCGNLIIDFYWGM
ELYPRIGKNFDIKVFTNCRFGMMAWAVLSVTYCIKQYEINGRVSDSMLVNTILTLVYVTK
FFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYLVNHPVELGTQLAIYILVA
GVLCIYINYDCDRQRQEFRRTNGKCSVWGKAPSKIVATYTTTAGETKTSLLLTSGWWGLA
RHFHYVPEILSAFFWTVPALFNNFLPYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYC
EKVRYRIIPGIY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcggagactgtgcattcaccgatcgtgacttacgcatcgatgctatcgcttctcgct
ttctgtccacctttcgtcatgctcctatggtacacgatggttcatcaggatggttctgtt
attcagaccagtggcttcttgtggcagaatggatttcaagggctcatcaacatatggcca
agacccactgcgatcgcttggaagataattttttgctatggagcatttgaggccactctt
cagctgcttcttcctggtaaaagagtcgaaggcccaatatctccgacaggaaaccgacca
gtttacaaggccaatggtttggcttcctattttgtgacactagccacctatcttggtctt
tggtggtttgggatattcaaccctgcaattgtctatgatcacttgggtgaaatattttcg
gcacttatatttggaagcctcgtattttgtgttttgttatacgtaaaaggtcacgttgca
ccttcatcaagtgattctggttcatgtggcaacctaattattgacttctactggggcatg
gagttgtaccctcggattggtaagaactttgacatcaaagtttttactaattgcagattt
gggatgatggcttgggcagttctttcagtcacgtactgcattaaacagtatgaaatcaat
gggagagtatctgattcaatgctggtgaacaccatactgacgctggtttatgtcacaaaa
tttttctggtgggaagctggttactggaacaccatggatatcgcacatgaccgagctggc
ttctatatctgctggggttgtctagtgtgggtgccttctatttatacctctccaggcatg
taccttgtgaaccaccccgtcgaacttggaactcagttggcaatatacattctggtggca
ggagttctttgcatttacataaactatgactgtgataggcaaaggcaagagtttaggagg
acaaatgggaaatgctcggtttggggcaaagccccgtcaaagattgtggcgacgtataca
acaacagctggtgaaactaaaaccagtcttctcttaacctctggatggtggggactggct
cgtcattttcattatgttcctgagatcttaagtgctttcttctggaccgtacctgctctc
ttcaataatttcttgccatacttctacgtcatatttctcaccattcttctctttgatcga
gccaagagagacgatgacagatgccgatcaaagtatgggaaatactggaagctgtactgc
gagaaagtgcgatacaggattattccgggaatttattga

DBGET integrated database retrieval system