KEGG   Eutrema salsugineum: EUTSA_v10012588mgHelp
Entry
EUTSA_v10012588mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
eus  Eutrema salsugineum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EUTSA_v10012588mg
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EUTSA_v10012588mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     EUTSA_v10012588mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 957 aa AA seqDB search
MSDEKIINNGEDVKSFQSSATKVDPAVPASLTWQRKIDSDVKAPREFALTAKEIFQLAPV
GIRLWFLCREEAAKGRLAFIDPFSKHSVTSSHGVPLGGVGAGSIGRSFKGEFQRWQLFPP
KCEDEPVLANQFSAFVSRNGKKYSSVLCPRNPKLGKQESECGIGSWDWNLTGDKSTYHAL
YPRSWTMYEGEPDPELRIVCRQVSPFIPHNYKDSSFPVSVFTFTLHNFGNTTADATLLFT
WTNSVGGDSEFSGGHYNSKIMMNDGVQGVLLHHKTAKGLPSLSYAISAQATDGVSVSICP
FFIVSGKQNGITAKDMWETIKEQGSFDHLNASETSMQSERGSSIGAAVAASATVPPGETR
TVTFSLAWDCPEVQFPSGKIYSRRYTKFYGTHGDAAAQIAYDAILGYSQWESLIEAWQRP
VLEDKRLPAWYPITLFNELYYLNSGGTLWTDGSPPLHSLAVVREKKFTLEKSQHSMKNII
DVPHQNDTAISVLEKMASTLEQLHASTTSNSAFGTKLLEEGEENIGHFLYLEGIEYRMWN
TYDVHFYASFALVMLFPKLELSIQRDFAAAVMLHDPTKVKTLSEGQWVQRKVLGAVPHDL
GINDPWFEVNGYNLHNTDRWKDLNPKFVLQVYRDVVATGDKKFALAVWPSVYVAMAYMAQ
FDKDGDGMIENEGFPDQTYDTWSASGVSAYCGGLWVAALQAASALAREVGDKNSQDYFWS
KFQKAKDVYEKKLWNGSYFNYDNSGSQYSSSIQADQLAGQWYARASGLLPIVDEDKARTA
LEKVYNFNVMKIKDGKRGAVNGMHPNGKVDTASMQSREIWSGVTYAISATMIQEGLTDMA
FQTASGVYEAAWSETGLGYSFQTPEAWNTNDQYRSLTYMRPLAIWAMQWALTKTSVQQQH
DLEPEPEPVSEPSSLMKHDIGFSRVSRLLNLPNEASPKGTLQTLFDYTCRRMMSYTH
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgaaaagatcataaataatggtgaagatgtaaaatctttccagtcttctgct
actaaagttgatccggcagtacctgcatcattgacatggcaaagaaagatagacagtgac
gtaaaggctccccgggaattcgctctaaccgctaaagagatatttcagctggctcctgtt
ggcattcggttatggtttctttgcagagaagaagccgcgaaaggaaggctggccttcata
gatccattctccaagcactctgtgacatcttcccatggtgttccacttggaggtgttggt
gctggtagcataggaaggagtttcaaaggtgaattccaaagatggcagctattccctcca
aaatgtgaagatgaaccagttcttgcaaatcagttctcagcatttgtttcacgtaatggt
aaaaaatactcaagcgtgttatgtcctaggaacccaaagctgggaaaacaagagtcggaa
tgtggaattggctcttgggactggaatctaacaggagacaagtctacatatcatgcttta
tatccaaggtcttggacaatgtatgagggtgaacctgatccagagcttagaattgtttgt
cgtcaagtttcacctttcatacctcacaactacaaagatagcagttttcctgtgtctgtt
ttcactttcacgcttcataatttcggaaacactactgcagatgcgacattgctctttact
tggacgaattctgttggaggggactcagagttctctggtggccactacaactccaagata
atgatgaatgatggagtccagggtgtgctcttacaccacaaaacagcaaaggggttacct
tctttgtcatacgcgatttcagctcaggcgactgatggtgttagtgtctcaatctgccct
tttttcatagtatctggaaagcagaacggaattacagcaaaagatatgtgggagactata
aaagagcaaggttcttttgatcacctcaatgcttctgagacatcgatgcaatcagagcgc
gggtcatcaattggggcagcagtagcagcctctgcaacagtcccaccaggagagacacgg
actgtcacattttctctggcatgggactgccctgaagtgcaatttccaagcggtaaaata
tattcaaggcgttacacaaagttttatggcacgcatggtgatgctgcagcacaaattgca
tatgatgctattcttggatatagtcaatgggaatctttgatagaagcttggcaaagacca
gtacttgaagataaaaggctgcctgcatggtaccctatcactctattcaacgagctttac
tatcttaattccggaggaactctttggacagatggatcaccaccacttcatagcttggca
gtagtcagagaaaagaagttcacacttgaaaaatcccaacacagtatgaagaacattatc
gatgtaccgcatcagaatgataccgctatctctgttcttgaaaaaatggcttctacgctt
gagcaacttcatgcatctacaacatcaaactctgcatttggcacaaaattactcgaggaa
ggagaagagaacattgggcacttcctttacctagaagggatcgaataccgtatgtggaac
acatacgatgttcatttctatgcgtcttttgcactggtgatgctatttccaaaacttgaa
cttagtatccagagagattttgctgcagcggtgatgttacatgatcccactaaagtgaaa
actcttagtgaaggacaatgggttcagagaaaggttcttggtgcagttcctcatgactta
ggcatcaacgacccttggtttgaagttaatggatataatcttcacaatacagatcggtgg
aaagatttgaatcccaaattcgtcctccaagtgtaccgagatgtagttgccactggagac
aagaagtttgcattagcagtctggccctccgtgtatgttgctatggcgtatatggctcag
tttgataaagatggcgatggaatgattgagaacgaaggatttccagatcagacttacgac
acatggtcagcgtctggtgttagcgcatactgtggtggactttgggtggctgcattacaa
gctgcatctgcattagcacgcgaagttggtgacaagaactctcaagactatttctggtca
aagtttcagaaagcaaaagatgtgtatgagaagaagttgtggaatggatcttactttaac
tacgacaacagtggaagtcagtatagctcgtctatacaggctgatcaactagctggtcaa
tggtatgcacgagcatcaggacttttgcctattgtagatgaagataaggctagaacagct
ttggagaaagtttacaacttcaatgtgatgaagattaaagatgggaaacgtggggctgta
aatgggatgcatcccaatggtaaagttgatacagcatcgatgcaatcacgagagatatgg
tctggtgttacatatgcaatctctgcaacaatgatccaagaaggtctaactgacatggcg
tttcagacagcaagtggcgtgtacgaggctgcttggtctgaaactgggcttggttactcc
tttcaaacgcctgaagcttggaacacgaatgatcagtatagatcattgacttacatgcgt
ccccttgccatatgggctatgcaatgggcattgacaaaaactagtgtacaacagcaacat
gatcttgaaccagagccagaaccagtatcagagcctagttctctaatgaaacatgatatt
ggtttctctcgggtttctaggcttctgaacctaccaaatgaagcatcgcccaaaggcaca
ctccagactttgttcgactatacttgccggagaatgatgtcatacactcattga

DBGET integrated database retrieval system