KEGG   Eutrema salsugineum: EUTSA_v10013461mgHelp
Entry
EUTSA_v10013461mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
eus  Eutrema salsugineum
Brite
Enzymes [BR:eus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     EUTSA_v10013461mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 466 aa AA seqDB search
MSLGYAEKLSFIEDVGQVGMAEFFDPSHVLQCKIEELAKMIQKSKHLVAFTGAGISTSCG
IPDFRGPKGIWTLQREGKDLPKASLPFHRAMPSMTHMALVELERAGILKFVISQNVDGLH
LRSGIPREKLSELHGDSFMEMCPSCGAEYLRDFEVETIGLKETSRKCSNEKCGAKLKDTV
LDWEDALPPKEIDPAEKHCKMADLVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTP
KDKKANVVIHGFVDKVVAGVMEALNMKIPPYVRIDLFQIILTQSLSRDQRYINWTLRVAS
VHGMTSQLPFVDSVEISFSDNQKYKETVLDKQPFLVKRRTSRTETFDIFLTVNYSGGCDC
LSTKLNIPFEFEVSTEEHGEIIDKEAVLRSLRERAVEESSCGQSGVVERRVVCEPRSEAV
VYATVTNLRTFICQQSLFANGDLKWKLEGSGTSRKRSRTGKRKSRA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggttacgcagagaaattatccttcatcgaagatgttggtcaagttggcatg
gccgaattcttcgacccatctcatgttctacaatgcaagatcgaagaacttgctaagatg
attcaaaagagtaagcatctagtggcctttacaggcgcaggcatctcaacttcttgtggt
atacctgatttccgaggccccaaaggaatttggacgttgcagcgtgaggggaaagattta
ccaaaagcatctctgccatttcatcgtgcaatgccgagcatgacccatatggctttggtt
gaattagagagagctggcattttgaaatttgtcatcagtcagaatgtggatggcttacat
cttcgatctggaattccaagagagaagctttctgagctgcatggagactcttttatggag
atgtgcccatcatgtggagcagagtacctgcgtgatttcgaggtggaaactattggattg
aaagagacatcaagaaaatgctctaatgaaaaatgtggagctaaacttaaagatacggtc
ttggattgggaggatgctttgcctccaaaagagattgatcctgcagagaaacactgcaaa
atggctgatcttgtactctgtttgggtactagtttgcagataactcctgcttgcaacttg
cctctcaaatgtctcaggggtgggggaaagatcgtgatcgttaatcttcagaaaacccca
aaggacaagaaagcaaacgtagtgattcacggttttgttgataaggtggttgcaggggtc
atggaagctctcaacatgaagatccctccatatgtcagaatagatcttttccagataatc
ctgactcaatccttaagcagagatcagaggtacattaactggacattgcgtgttgcgagt
gtccatggaatgacttctcagttaccgtttgtcgattcagtagagatttctttctcagat
aaccagaagtacaaagaaacagttcttgataagcagccttttcttgtgaaaaggaggaca
tcacgaaccgaaacatttgatatattcttgacagttaactacagtggcggttgtgattgc
ctctccaccaaacttaacattccctttgaattcgaggtttcaacagaagagcatggagag
attattgacaaggaggctgtgctacgaagcctgagagaaagagcggttgaagaatccagt
tgtggtcaaagcggtgtggttgagagaagagtggtttgtgaaccgagaagtgaagccgtt
gtgtatgcgactgtgaccaatctcaggactttcatctgtcaacaatctctgtttgctaat
ggagacctcaaatggaagctggaaggttctggaacctcccgtaagcgttcaagaaccggg
aagcgaaaatcgagggcatag

DBGET integrated database retrieval system