KEGG   Eutrema salsugineum: EUTSA_v10013550mgHelp
Entry
EUTSA_v10013550mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
eus  Eutrema salsugineum
Brite
Enzymes [BR:eus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EUTSA_v10013550mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 444 aa AA seqDB search
MGSSANTETNGTASSPSSNHKPPATNGAEAPLNQPHSTPDQAISESDQSKKRKMGMLPLE
VGTRVMCRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFNRRLDEWTHLDQLDLDSV
ECAVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGK
YEIETWYFSPFPPEYNDCVKLFFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTL
SMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEK
HSEEAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWT
RVLLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRHL
KAAGRGGLDVDVSKLIWTPYKDQS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgtctgcgaatacagaaaccaacgggacagcctcgtcaccgtcgtcgaatcac
aagcctccggctacgaatggcgctgaggcgcctctgaatcaacctcattctactcctgat
caggcgatctcagagtcggatcagtcgaaaaagaggaaaatggggatgcttccgctcgaa
gtgggtactcgcgtgatgtgtcgatggagagacggaaaacaccatccggtgaaagtaatc
gagcgccggaggattcataacggcggccaaaatgattacgagtattacgttcattacaca
gagtttaataggaggctggatgaatggactcacctggaccaactggaccttgattcagta
gagtgcgccgttgatgaaaaagttgaagacaaggtgactagcttgaagatgacacgccac
cagaagcggaagatcgatgagacacatgtagagggtcatgaagagttggatgcagcaagt
ttgcgtgaacatgaagagttcacgaaagtgaagaacatagcaacgattgagcttggaaaa
tatgagattgaaacttggtacttctccccttttccgccggaatacaatgactgtgtgaag
ctcttcttttgtgagttttgcctgaatttcatgaaacgcaaagagcagcttcaaaggcat
atgaggaagtgtgatctgaagcacccccctggtgatgaaatttatcgaagtggtaccttg
tcaatgtttgaggtagatggcaaaaagaacaaggtctatgcgcagaatctctgttacctg
gcaaagttatttcttgaccacaaaactctttactacgatgttgatttgtttctgttctac
gttctttgcgaatgtgatgatcgaggatgccacatggttggatacttttcaaaggaaaaa
cattcggaagaagcctacaacttagcttgcattctaactcttcctccgtatcaaagaaaa
ggatatggcaaattcttgatagccttctcttatgaactgtcaaagaaagagggaaaagtt
gggacaccggaaagacccttgtcggatctaggcttgctaagttacagaggttattggacc
cgtgttctattagacatcttgaaaaaacataaaggaaacatttctatcaaggagctgagt
gacatgacagcaatcaaagcggaagatatattaagcacacttcagagcctagaactgata
cagtacaggaaaggacaacacgtgatctgtgctgatccaaaggttctggaccgacatctg
aaagctgcaggtcgaggtggacttgatgttgatgttagcaaactgatttggacaccttac
aaggaccagagttga

DBGET integrated database retrieval system