KEGG   Eutrema salsugineum: EUTSA_v100141990mHelp
Entry
EUTSA_v100141990m CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
eus  Eutrema salsugineum
Pathway
eus00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EUTSA_v100141990m
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     EUTSA_v100141990m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18018405
NCBI-ProteinID: XP_006400575
UniProt: V4LQC9
Position
Unknown
AA seq 176 aa AA seqDB search
VYPDGKMSQHFASLKPGDVLEVKGPIEKFKYSPNMKKHIGMIAGGSGITPMLQVIDAVMK
NPEDNTQITLLYANVSPDDILLKQKLDVLQANHPNLKVFYTVDNPTKNWKGGVGYISKDM
ALKGLPLPADDTLILVCGPSGMMEHISGGKAPDWSQGEVKGILKELGYTEQMVFKF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtatatccagacggaaaaatgagtcagcattttgccagcttaaaaccgggggatgtgttg
gaagtgaaaggacccattgaaaagttcaaatattcgcctaatatgaagaaacatattggc
atgattgctggtggaagtgggataactccaatgcttcaggtgatcgatgctgttatgaag
aatcccgaggacaacacgcagataacattgctttatgccaatgtttcgccggatgatata
cttctcaagcaaaagctcgatgtacttcaggctaaccacccaaatttgaaggtattctat
actgttgacaatcctactaaaaactggaaaggaggagtaggttacatttcaaaagatatg
gctctgaaaggcttacctcttcctgcagacgacacacttatccttgtatgtggtccttct
gggatgatggagcatatatccggaggcaaagctccagactggtctcaaggagaggtcaag
gggatactcaaggaactcggatacacagagcagatggtattcaaattctga

DBGET integrated database retrieval system