KEGG   Eutrema salsugineum: EUTSA_v10016835mgHelp
Entry
EUTSA_v10016835mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
eus  Eutrema salsugineum
Pathway
eus00561  Glycerolipid metabolism
eus01100  Metabolic pathways
Module
eus_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EUTSA_v10016835mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     EUTSA_v10016835mg
Peptidases [BR:eus01002]
 Serine Peptidases
  Family S33
   EUTSA_v10016835mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_2 DLH FSH1 Abhydrolase_5 Esterase
Motif
Other DBs
NCBI-GeneID: 18027281
NCBI-ProteinID: XP_006411167
UniProt: V4LPY4
Position
Unknown
AA seq 365 aa AA seqDB search
MKNFRGMGVSEQFQDLKEKPYRYLLSYFPLQQNKIKRERETSINLFVIMASETEDIKYEE
SFIKNSRGMKLFTCKWLPANQEPKALLFICHGYAMECSITMNSTARRLVKAGFGVYGMDY
EGHGKSDGLSAYVPNFDHLVDDVSAHYTSVCEREENKEKMRFLVGESMGGAVLLLLHRKK
PEFWDGAVLVAPMCKIAEEMKPSPVVISILSKLSGVIPTWKIIPGQDIIETAFKQPEIRK
QVRENPYCYKGRPRLKTAYELLRISTDLEKRLNEVSLPFMVLHGEDDKVTDKAVSRELYE
VASSSDKTFKLYPGMWHGLLYGETPENIEIVFADIINWLDKRASDGNGSFESELKRKNDG
LPLKG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttcgagggatgggggtttctgaacagtttcaagacttaaaagaaaagccg
tataggtatctcttatcatactttcctctccaacaaaataaaataaaaagagagagagag
acttcgatcaacctcttcgtaattatggcaagtgaaacagaggacatcaagtatgaagag
agtttcataaagaacagtcgaggaatgaagctgttcacgtgcaagtggttaccagcaaat
caagaaccaaaggctttactcttcatttgccatggatatgcaatggaatgtagcatcacc
atgaacagtaccgcgaggaggcttgtgaaggcaggatttggtgtgtatggaatggattat
gaaggacatggaaaatctgatgggcttagtgcttatgtcccaaactttgatcatcttgtt
gatgatgtctctgcccactacacatccgtctgcgagagagaagagaataaagagaagatg
aggtttttggttggagaatcaatgggaggagcagtccttttgctgttacacagaaagaag
cctgagttttgggatggggccgtcttggttgctccaatgtgtaagatcgctgaagaaatg
aaaccaagccctgtggttatctcgatattgtcgaaacttagcggagtcatacccacgtgg
aaaattatccctggccaagatattattgagactgctttcaagcagccagaaatcaggaaa
caggtcagagaaaatccttactgctacaaaggtcgtccacgcttgaagactgcttatgag
ctattgcggattagcaccgatcttgagaagagactgaatgaggtttcattaccgttcatg
gttttgcacggagaagacgataaagtgactgacaaggcggtgagccgagaactgtatgaa
gttgcttcgagttcggacaagactttcaaactgtatcctgggatgtggcatggtttactc
tatggcgagacaccagagaatatcgagattgtgtttgctgacatcattaattggctggac
aagagagcttccgatggaaatggaagctttgaatccgagcttaaacgtaagaatgatggt
cttcctttgaaagggtag

DBGET integrated database retrieval system