KEGG   Eutrema salsugineum: EUTSA_v10017013mgHelp
Entry
EUTSA_v10017013mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
eus  Eutrema salsugineum
Brite
Enzymes [BR:eus01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EUTSA_v10017013mg
Peptidases [BR:eus01002]
 Cysteine Peptidases
  Family C86
   EUTSA_v10017013mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 295 aa AA seqDB search
MSNYESQIYHERQRLQFCLLHALNNLFQDKDAFTRENLNSIAEELVADDPNKETWTPLSL
LLKPHHNTLTGNYDVNVMIAALEGKGKSVVWHDKRLGASSIDLDSDTLMGIVLNVPVKRY
GGLWRSRHWVVMRRINGVWYNLDSDLVVPKPFKDEDEFRGFLDQNLSSGTKRLNANTRPV
TSAKQSSVKGPYGKNPGCTTSCGLRLPRKTEVTAARLINHLSSKFVKGLRLVVMRKKKKK
RSPPSKASSTGRSQTSVISVANDNTCRSEAIEDCIQFINSSTSFTRSTSATGRTS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattacgaatctcagatctatcacgagcgacaacgattgcaattctgcctcttg
cacgcccttaacaatctatttcaggacaaggacgcattcacgcgggaaaacttgaactca
atcgcggaggagctcgttgccgatgatccgaacaaagaaacgtggacgcctctctctttg
ctcctcaagcctcaccacaacacgctcaccggaaactacgacgtaaacgtgatgatcgca
gctcttgaaggcaaaggcaagagtgtcgtttggcatgataaacgtcttggagcttcttcg
attgatcttgattcggatactctaatgggtatcgtgttgaatgttccggtgaagcgatat
ggtggactttggagaagcagacattgggttgtgatgagaagaatcaatggagtctggtat
aacttggacagtgatctcgttgtgccaaagccgttcaaagacgaagatgaatttaggggg
ttcttggatcaaaatctgagttcaggaacaaaacggttaaatgcaaacactagaccagta
acttctgctaagcaatcctcagtcaagggaccgtatggtaagaatccgggatgcacaaca
agctgtggcttgaggctaccgaggaaaacagaagttactgcagcaagactgatcaaccat
ctcagctctaaatttgtcaaggggttacgtctagtggtgatgaggaagaagaagaagaag
agatctccaccatcgaaggcttcttccaccggtagatctcagacttcggttatctctgtc
gctaatgataatacctgtagatcagaggctatagaagactgcatacagttcataaactca
tcgacctcgttcacacgatcaacttctgccactggccgtacatcttga

DBGET integrated database retrieval system