KEGG   Eutrema salsugineum: EUTSA_v10018799mgHelp
Entry
EUTSA_v10018799mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
eus  Eutrema salsugineum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EUTSA_v10018799mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     EUTSA_v10018799mg
    2.7.1.82  ethanolamine kinase
     EUTSA_v10018799mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 348 aa AA seqDB search
MAIKTKSSLIPSCASPEDLKRVLQTLGSSWGDVVEDLERLEVVPLKGAMTNEVYQISWPT
LDGEDVHRKVLVRIYGDGVDLFFNRDDEIKTFECMSHHGYGPKLLGRFSDGRLEEFIHAR
TLSAGDLRKAETSDFIAAKLREFHKLDMPGPKNILLWQRLRNWLKEAKNLSSPIEIDEFR
LEALEGEINLLEERLTRDDQEIGFCHNDLQYGNVMIDEETNAITIIDYEYSSFNPVAYDI
ANHFCEMAANYHSDTPHILDYTLYPGEEERRRFISTYLGSTGNATSEEEVERLMSDAENY
TLANHLFWGLWGIISGHVNKIEFDYMEYARQRFEQYWLRKPLLFKDVE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagacgaagagtagtctaattccgagctgtgcatcaccggaggatctgaaa
cgcgttttgcaaacgctaggttcgagctggggagacgtggttgaagatctggagcgtctt
gaggttgttccgttgaaaggagccatgacgaacgaggtttatcagattagctggcctacc
ttagacggcgaagatgttcaccggaaagttcttgttcggatctacggagacggcgtcgat
cttttctttaacagagacgacgaaatcaaaacctttgagtgtatgtctcaccatggttat
ggccctaagctccttggccgcttctccgatggtcgccttgaagaattcatccacgcgaga
actctttctgcaggtgatctccgtaaagcagaaacatctgatttcatcgcagctaagcta
agagagtttcacaagcttgatatgcctggtccaaagaacattctcctctggcaaagactc
aggaattggctcaaggaagccaagaacttgtcttcaccaatagagattgatgagtttcgc
ttggaagctttggaaggtgaaatcaacttgttggaggagaggttgactcgtgatgaccaa
gagatcggtttctgtcacaacgatcttcagtacggtaacgtcatgattgatgaagaaacc
aatgctattaccatcatcgactatgagtactcgagtttcaacccagttgcttatgacatc
gccaaccacttctgcgaaatggctgctaattaccattcagacactcctcatatccttgac
tacactctatatccaggagaagaagaacggagaaggttcatcagcacataccttggctct
acagggaatgcaacaagtgaggaagaagtggagaggttgatgagtgatgcagagaactac
actttagcaaaccatcttttctggggattatggggaatcatctcggggcatgtgaacaag
attgagtttgactacatggaatatgcaaggcagagatttgaacagtactggcttagaaag
cccctgcttttcaaggatgtagaatga

DBGET integrated database retrieval system