KEGG   Eutrema salsugineum: EUTSA_v10019887mgHelp
Entry
EUTSA_v10019887mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
eus  Eutrema salsugineum
Brite
Enzymes [BR:eus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EUTSA_v10019887mg
Transcription factors [BR:eus03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    EUTSA_v10019887mg
Mitochondrial biogenesis [BR:eus03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    EUTSA_v10019887mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1666 aa AA seqDB search
MAQGQNRNVLLPGHMQNSASSVSSQPNGISHDGLRVRHEMLNRIYAWLQQRQPSKTDDAS
KAKLFDVAKRLETAMLKTAKSKEDYLDFRSFEVRIESTLNQLFSQRRANPSSSVGMMVPT
PGVSHGWGQSHTATPMVDMNTFNSNNNLAGATIETGRLLPTNRMNGGSIVNGRQQLSAGF
SVSSDDTGQMMPTPGFNNSVNADVYHSHRNEENSRDGGKLLAVGSEFGNPSQLQRQRPAA
GYDRMHSNLDHQLGGGFRSNMHQNAGVGMSGNNVQLANGRRSSEGVLSSTQFSTSSQPLH
QPVDQLKVSHVHRYSMGNSDTFGTGNLYGVLTSSGSMETAVDSVSLNPMRRVDASFANNQ
SGLHAAAKNPLLKPQLLQQFENGNFQSSSSSRANLAQVSHQPLENQFNQPAHHGQYQQQE
HLMNNDAYRQSQLASNFVSQVKHEPRVEYYNEAFQLQALNKVEPSKSQNQYKQNTVKDEY
VGAQSATVCSSQPIISSSFPPQTHQTQEVSQWKDLGNVSVGVQPVSGLGQWHSSSQNLTQ
ISKDSNGEREHFGVNLGQRLPMQHEATNDSSSVRESTNCQTVAPRSTLEAPHLPEGSNTL
SKQLNGDCGLSYINQRRWLLFLLHVRKCNAAEDNCESKYCFTAKTLLKHINYCKAPACAY
QYCLQTRKLINHNKNCGNEACPVCVYVRNFKEKQKEKIALLRRAEPISASLNHGHKEPFE
SMRASSERDSEAPSVDDLQPSPKRLKVEKPSQFAYHDTHSVPANISAGVSKAHFSMGLQE
KYSVQSDVCKTVRSDVPMNADSSDSSRRIVPVSRELEKPVCKDTPMGRHGGDSSFDGKTV
CLPEQEKPKCVKEISVPKEEKAEQSAGVVAASNSGKSKIKGVSLIELFTPEQVEEHIRGL
RQWVGQSKTKAEKNKAMGLAMSENSCQLCAVERLAFEPTPIYCTPCGARVKRNAMHYTVV
AGESRHYVCIPCYNETRTNTVTIDGTPVPKSRFEKKKNDEEVEESWVQCDKCQAWQHQIC
ALFNGRRNHGQAEYTCPNCYIQEVEQGERKPVSQSVILGAKSLPASTLSNHLEQRLFKKL
KQERQERARLQGKSYEEVPGADSLVIRVVASVDKILEVKPRFLEIFREENYSSEFPYKSK
AILLFQKIEGVEVCLFGMYVQEFGTDSASPNQRRVYLSYLDSVKYFRPDVKTVSGEALRT
YVYHEILIGYLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKTDKLREWYLAML
RKASKEKVVVECTNFYDHFFVQSGECRAKVTAARLPYFDGDYWPGAAEDLIDQMSQEEDG
KKSNRKVMPKKVISKRALKAVGQLDLSVNASKDLLLMHKLGEIILPMKEDFIMVHLQHCC
KHCCTLMVSGNRWVCHQCKNFQICDKCYEVEENRLEKEKHPVNQKEKHVLYPVAIDDVPT
EIKDNDGILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMILYHLHNPTVPAFAIAC
AICQQELEPAQGWRCEVCPDYDVCSACYSKGINHPHSLITRPSATDSVVQNTHTNQIQTA
QLRELLLHVIACCTAQCQYPRCRMIKILFRHGVACKTRGCIHCKRMWALFRMHARNCRDP
QCRVPKCRDLRAHFSRKQQQADSRRRAAVMEMVRQRAADAETSTPD
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggcagaacaggaatgttcttctgccaggacacatgcagaattctgcttcc
agtgtttcttctcagcctaatggcatatctcatgatggtctcagagtacggcatgagatg
ctcaacagaatctacgcatggttacagcagaggcagccttcaaagactgatgatgcctcc
aaggcaaagttatttgatgttgcaaaacggttagaaactgcaatgttaaaaacggctaag
tcaaaggaggattacttagatttccgaagttttgaggttcgcatagaatctactctgaat
caactttttagtcaacgccgtgctaatccttcaagttcggtcggtatgatggtcccaaca
cctggagtttcgcatggatggggtcaaagtcatacggccacacctatggtggatatgaac
acctttaatagtaataataacttagcaggtgcaacaatcgaaactggaaggctattgcca
actaatcgcatgaatggaggctcaatagttaatggtcgccagcaattgtctgcgggattt
tcagttagttctgatgacactggccagatgatgcctactcctggatttaacaatagtgtt
aatgctgatgtatatcattctcatcgaaatgaagaaaattctagagatggtggcaagctt
ctggctgttgggtctgaatttggaaatccatctcagctgcagaggcaacgtcctgctgct
ggttatgaccgtatgcatagcaaccttgatcaccagttgggaggtggtttcaggtcaaac
atgcaccagaatgctggtgtagggatgagcgggaacaatgtacagcttgctaatggccgc
aggagttctgaaggggtccttagttccacgcaattttcaacttcatcccaacctttgcat
cagcctgtcgatcagttgaaggtgtcacatgtgcacagatattcaatgggaaactctgat
acttttgggactgggaatctctatggagttctgacatcatctggctcaatggaaactgct
gtggattcagtgagtctgaatcctatgcggagagttgatgcttccttcgctaataatcag
tctggcttgcacgcagcggcaaaaaatccattgctaaaacctcagctacttcaacagttc
gagaatgggaatttccaatcttcttccagttccagagcaaatttggctcaggtgagtcat
caaccattagaaaatcagttcaaccagccagctcatcatggtcaataccagcaacaagag
cacttaatgaacaatgatgcttatcgtcaatctcagttagcttcaaattttgttagtcaa
gttaagcatgaacctcgcgtggaatactacaatgaagcatttcagctgcaggctttaaac
aaagtagaaccatccaagtcgcaaaaccagtacaagcagaacactgtcaaagatgagtat
gttggtgctcagagtgcaacagtttgtagtagccagcctattatttcttcatctttccca
ccgcaaactcatcagacgcaggaggtatcacaatggaaagatttgggtaacgtctcagtt
ggcgtgcagccagtatcaggtctgggtcagtggcattcatcttctcagaacttgacacaa
atatcaaaagattcgaatggagagagagaacattttggggtaaacttaggtcaaagattg
cctatgcagcatgaagctactaacgatagttcgtctgtaagagagtctacaaattgccaa
actgtggctcctagaagcaccttggaggctccacatctcccagaaggaagcaacaccttg
agtaaacagctgaatggagattgtggtttaagttatataaatcagaggcggtggcttttg
ttcctgctacatgtacgcaaatgcaatgcagcggaagataactgtgaaagcaagtattgt
tttactgccaaaacgctattgaagcatatcaattactgcaaggcccctgcttgtgcatat
caatattgtcttcaaacccgaaaattgattaatcataacaagaactgtgggaatgaagca
tgtccagtctgtgtttatgtcagaaacttcaaggagaaacaaaaagaaaagattgccctc
ctccgacgagccgagcctatctcagccagtttaaatcatggacacaaggaaccctttgag
tctatgcgtgcttctagtgaaagagactctgaagctccatctgttgatgatttgcaacct
tctccgaagcgcttgaaagtagagaaaccctcccagtttgcttatcatgacacacacagc
gtcccagcgaacatatctgctggtgtcagtaaagctcatttttcaatgggtttgcaagag
aaatatagtgtacaaagtgatgtttgcaaaactgttagatcagatgtgcctatgaacgca
gatagttccgattcttcgaggagaattgttccagtttcccgtgagctggagaagcctgtt
tgtaaagatacccccatgggaagacatggtggagactcttcattcgatggtaaaactgtt
tgtttaccagagcaagaaaaaccaaaatgtgtgaaagaaataagcgtacccaaagaagag
aaagcggaacagtctgcgggcgttgtagctgcgtctaatagcggaaagtcaaagataaag
ggagtctcactgattgaactgttcactccagagcaagtagaggagcatatccgcggtctt
cgtcagtgggtaggccagagtaaaaccaaggcagaaaaaaataaagcaatgggactcgcc
atgtccgaaaactcttgccagttatgtgctgttgagaggcttgcatttgagccgacacct
atttattgcacaccatgtggtgcacgtgtcaagagaaacgctatgcactatactgttgtg
gctggtgagtcacggcattatgtctgcattccctgctacaatgaaacgcgtacgaacact
gttactattgatggaactcctgtgccgaagtcgaggtttgagaaaaagaaaaatgatgaa
gaggttgaagaatcgtgggtgcaatgtgataaatgtcaagcatggcagcatcaaatttgt
gctttgttcaacggccgtaggaatcatgggcaagccgagtacacttgccctaattgctat
atacaagaggtggaacaaggagaaaggaaaccagtatcacaaagtgttattctgggggca
aaaagtttaccggctagtactcttagcaaccatttagaacagcggttgttcaagaaatta
aagcaggaaagacaggagagggctagacttcaaggaaaaagctacgaggaggtcccggga
gccgactcacttgttatcagagttgttgcatccgtcgacaaaatattagaagttaagcca
cgcttccttgaaatattccgagaagaaaattactcatcagaattcccttataagtctaag
gccattctgctgtttcagaagatcgaaggtgttgaagtatgcttatttggcatgtacgtc
caagaatttggaacagattctgcgtctcccaatcagcggcgggtatacctttcctatctg
gactcggttaagtactttagacctgacgttaaaacagtatctggagaggccctccgtact
tatgtataccatgaaattctgattggttatctagattactgtaagaaacgtgggttttca
agctgctatatatgggcatgcccccctctcaagggtgaagattatattctatattgtcat
cctgaaattcagaaaacgccaaagactgacaagctaagggaatggtatttagcgatgctc
agaaaagcttccaaggaaaaagtggtcgttgaatgtacaaatttttatgatcattttttc
gtccagtctggtgaatgtagagcaaaggtaacagcagcaaggttgccatattttgatggg
gactattggccaggcgccgctgaggatttaatagatcaaatgagccaagaagaagatggc
aaaaagtcaaatagaaaagtaatgccgaaaaaggtcatatcgaaaagggctctaaaagca
gttggacagttggacctttctgttaatgcctcaaaggatctactgctaatgcataaactg
ggtgagatcatcctcccaatgaaggaagatttcatcatggttcatttgcaacattgttgc
aagcattgttgcactctcatggtatctggaaatcggtgggtgtgccaccagtgtaaaaat
tttcagatttgtgacaagtgttatgaagtggaagagaaccgtctcgaaaaggagaaacac
cccgtcaatcagaaggagaagcatgtactgtatcctgttgcaattgacgacgttcctact
gaaattaaggacaatgatggcatccttgagagcgaattctttgatactaggcaagctttc
ctaagtctttgccaaggaaaccattatcagtacgacacactaagacgggctaaacactct
tccatgatgattctctatcatcttcacaacccaaccgtgcctgcatttgcaatagcatgc
gccatctgccagcaagagcttgaacctgctcaaggttggcgttgtgaggtttgtcctgac
tatgatgtttgcagtgcttgctactcaaaaggcatcaaccatccacatagccttattacc
cgtccatctgcgactgattctgttgtacagaacacacacactaatcaaatccagactgca
cagttaagagaactgctgttgcacgtgattgcatgctgcactgcacagtgccagtatcca
aggtgtcgcatgattaagattctattcaggcatggtgttgcatgcaaaaccagaggttgc
atccattgtaagagaatgtgggccctcttccgaatgcacgcccgaaactgcagagatccc
caatgcagagtgcccaaatgcagggacttgagagctcattttagtagaaagcaacaacag
gcagattcaagacgcagagcagctgtgatggagatggtgaggcagagagccgctgatgca
gaaacatccactcctgactga

DBGET integrated database retrieval system