KEGG   Eutrema salsugineum: EUTSA_v10021971mgHelp
Entry
EUTSA_v10021971mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 356 aa AA seqDB search
MVSLCTILKPLSPVSPFVKHHNLRNRNALFTHHTPNSTNSLLSKRAGSVAHKKHTFMAVH
DTPVQVESSWGIPLTEGLVVRKKCAFWERSWTSWDVSKLVMFVGLHLLSLSAPVYFSWAA
FRLFLWLAVIIGFCITLSYHRNLSHRSFDLPKWLEYLFAYGGVLSFQGDPIEWVSNHRYH
HKHCDTQLDPHSPTQGFWFSHMTWIFDTGSILKKNVNDLVRQPFYRFLQRTFLLHLMAFA
TLLYICGGMPFLVWGIGVATTVRLHGTFLVNSVCHIWGKRAWNTPDFSKNNWWAAIITLG
EGWHNNHHAFEFSARHGLEWWQLDVTWYLIRFLEAIGLATNVKLPSQAQKKRMALV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtttctctatgtacaattctcaaaccgctttctccggtttcaccatttgttaaacat
cataacctcagaaatcgtaatgccttgttcactcatcacacacctaactctacaaactcc
ctattgtccaaacgagcaggatccgtggctcacaagaaacacacgttcatggcagtacat
gatacaccggttcaggtcgagagctcctggggaattcccttgacggagggtttggtggtg
agaaagaaatgtgcattctgggaaaggagttggacttcctgggacgtgagcaagttagtc
atgttcgttgggcttcatttgctgagcctctcggctccagtttacttcagctgggcggct
tttaggcttttcctttggctggctgtgatcattggattctgcatcaccttgtcttatcat
aggaatctttctcaccgaagtttcgatctaccgaaatggctcgagtatctctttgcttat
ggtggtgttctgtcttttcagggagacccaatagaatgggtgagcaaccatcggtaccat
cataagcattgtgatacacaacttgacccacacagccctacacaagggttttggtttagt
cacatgacttggatatttgataccggttctatcctcaaaaagaatgtaaatgaccttgtg
aggcagcccttctataggttccttcagcgaacctttcttttgcatctgatggcttttgcc
actctcctctatatttgtggaggcatgcctttcctcgtctggggaataggtgtggcaact
acggttcgactccacgggacttttctggtgaactcagtttgccatatatggggaaaacga
gcttggaacacacctgacttctccaaaaacaattggtgggcagcgataattacacttggc
gaaggatggcataacaatcatcatgcgttcgagttctctgcaaggcatggactcgagtgg
tggcaactagacgttacttggtatctcattaggtttcttgaagctattggtttggccact
aacgttaagctaccttctcaagctcaaaagaagagaatggctttggtttga

DBGET integrated database retrieval system