KEGG   Eutrema salsugineum: EUTSA_v10025232mgHelp
Entry
EUTSA_v10025232mg CDS       T02985                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
eus  Eutrema salsugineum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUTSA_v10025232mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EUTSA_v10025232mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 437 aa AA seqDB search
MTCLNETLLLSCLLAFLVFFPTFTFSTLLLFQGFKWESWKQEGGFYNSLQNSIDDISNSG
ITHIWLPPPSQSVSPEGYLPGKLYDLNSSKYGSETELKSLIAALNQRGIKSVADIVINHR
TGERKDDHCGYCYFEGGTSDGRLDWDPSFVCRDDPKFPGTGNSDTGKDFDGAPDIDHLNP
RVQKELSEWMNWLKSEIGFSGWRFDFVRGYAPSITKSYVKNTSPEFAVGEKWDDMKYGGD
GKPEYDQDEHRSALRHWIEEAGGGGGVLTAFDFTTKGILQSAVGGELWRLKDSQGKPPGL
IGIMPGNAVTFVDNHDTIRPNTWAFPSDKVLLGYVYILTHPGTPCIFYSHYMEWGLKDSI
TKLVAIRKRNGIGSTSSVTIKAAESDLYLAVIDDKVIMKIGPKMDLGTLVPSNYALAYSG
LDCAVWEKQLRNYSISL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacttgtctcaatgaaacgttactcttgtcttgtcttctcgctttcctcgtcttcttt
ccaaccttcacgttttccaccttattattgtttcagggtttcaaatgggaatcatggaag
caagaaggaggattctacaattctctacaaaactccatcgacgacattagcaactctgga
atcactcatatctggcttcctcctccttctcaatccgtttctcctgaagggtacttaccg
ggaaagctctacgatttgaacagctccaaatacggttcagagacggaattgaagtcacta
atcgcagcactgaatcaaagaggaataaaatccgtggctgatattgtgattaaccacaga
acaggtgagaggaaagacgatcactgtgggtattgttatttcgaaggtgggactagcgat
ggtcgtctagactgggacccttccttcgtctgtcgcgacgatcctaaatttcccggcacc
ggaaactccgacaccggcaaagatttcgatggtgcgccagacatcgaccaccttaaccca
agggttcaaaaggagctgtcggaatggatgaactggctcaaatctgaaatcggattcagt
ggttggagattcgatttcgttcgaggttatgctccttccatcaccaaatcatacgtaaag
aatacttcgccggaatttgcggttggtgagaaatgggacgatatgaagtacggaggagac
ggcaaaccggagtatgatcaggacgagcatcggtcggctctcagacactggatcgaggaa
gcaggtggtggtggtggtgtcttgacagcttttgatttcacgaccaaagggatcttacag
tctgcggtcggaggtgagctttggagactaaaggactcgcagggaaagccgcctggtctt
atcggaatcatgcccggaaatgcagtcactttcgtagataaccacgataccatcagacca
aacacgtgggcttttccttccgataaagtcttgcttggatacgtttatattcttactcac
ccaggcactccttgcatcttttatagtcattacatggaatggggtctaaaagatagtatc
acgaagttggttgcaatcaggaagagaaatggcattggtagcacaagctctgttacgatc
aaagcggccgagtcggatctctacttggctgtgattgatgacaaggttatcatgaagatt
gggcccaagatggatttgggaactctcgttccttccaactatgctctagcttattcaggt
cttgattgtgctgtatgggagaaacagttacgcaattactcaatttctctataa

DBGET integrated database retrieval system