KEGG   Echinicola vietnamensis: Echvi_0294Help
Entry
Echvi_0294        CDS       T02388                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
evi  Echinicola vietnamensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:evi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:evi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303737..305044
Genome map
AA seq 435 aa AA seqDB search
MSSFRVKGGLKLKGEITPQGAKNEALQILCAVLLTEETVHIHKIPNIRDVNKLIELLADM
GVEVSKTGPESYQFNAAKVDLDYLDTDKFLTKASSLRGSVMLLGPLLARFGKGKISKPGG
DKIGRRRLDTHFVGFQKLGAKFNYDTKREIYNIDGHALKGTYMLLDEASVTGTANILMAA
VMAEGKTTIYNAACEPYLQQLCDMLNRMGANITGVGSNLLHIEGVKKLNGTEHTLLPDMI
EIGSFIGLAAMTQSEITIKDAQIHRLGIIPDTFKRMGIQMEFRGDDIHIPAQKHYEIETF
IDGSILTVADAIWPGFTPDLLSIVLVTATQAKGTVLVHQKMFESRLFFVDKLIDMGAQII
LCDPHRATVIGLDRKYPLKGIRMTSPDIRAGVSLLIAALSAEGQSIIDNVEQIDRGYQYI
DQRLNALGADIVRID
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcattccgagtaaaagggggattaaaacttaaaggcgagatcaccccacaaggt
gccaaaaacgaggcactacagattctatgtgctgtacttttgacagaagaaactgtccat
atccataaaatcccaaacatccgagacgtcaacaaactgattgagcttttggcagacatg
ggtgtcgaggtttctaaaacaggcccagaaagctaccagttcaatgccgccaaggtagac
ctggactatctggacaccgataagttcctcaccaaagcctcttccttgcggggctctgtc
atgttacttggaccgcttttggccaggtttgggaaaggtaaaatctccaaacccggtgga
gataaaattgggcgaaggaggctggacacccattttgtgggcttccaaaaattaggcgcc
aaattcaactatgacaccaaaagggaaatctacaatatcgatggccatgccctgaaaggc
acctatatgctattggatgaagcatcggtaaccggcaccgccaatatcctgatggcagcc
gtcatggcagaaggcaaaaccaccatctacaatgcggcttgcgagccctacctccagcag
ctttgtgacatgctcaaccgaatgggcgccaacatcaccggcgtaggctctaacctactt
catatcgaaggcgtcaaaaagctgaacggaacagagcatacgttacttccggacatgatc
gaaatcggctcgttcattggccttgctgccatgacccagtcagaaatcaccatcaaggac
gcccaaatccatcgtttgggcatcatcccggataccttcaagcggatgggcatccaaatg
gaatttagaggagatgacatccacattcccgcccagaaacactacgaaatcgaaacattt
atcgacggctctatccttaccgtagcggacgccatctggccaggcttcacgcccgacctg
ctgagtatcgtcttggtaacggccacccaggccaaaggcactgtactcgttcaccaaaag
atgttcgaaagccgtctgttcttcgtcgacaaacttattgacatgggcgcgcagatcatt
ctttgtgacccgcacagggctacggtcataggcttggaccgaaaatacccgctgaaaggc
atccgaatgacctctccagatatcagagcaggtgtttccctcttgattgcagcgctttct
gctgaaggccagtcgatcattgacaatgtcgaacaaatcgaccggggataccagtacatt
gaccaacggctgaatgcgctgggagcagacattgtccggatcgattaa

DBGET integrated database retrieval system