KEGG   Echinicola vietnamensis: Echvi_0772Help
Entry
Echvi_0772        CDS       T02388                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
evi  Echinicola vietnamensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Echvi_0772
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Echvi_0772
  Amino acid metabolism
   00310 Lysine degradation
    Echvi_0772
Enzymes [BR:evi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Echvi_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(868701..870275)
Genome map
AA seq 524 aa AA seqDB search
MSLEIKVPAVGESITEVTIGQWFKNSGEYVEMDEVICELESDKATFELTAEADGILTVKA
EAGDTLEIGAVICEIDTKASADDAAPAKEEKKEAPADSKESKGSSSDSKSGKTGEVKEMV
VPTVGESITEVTLASWLKEDGDFVEMDEIIAEVDSDKATFELPAEAQGILKRVAEEGDTL
EIGGLICKIEVVEGDAPEADDTADTSKEESTSSASSSGSGSYAEGHASPAAAKILAEKGI
DAKEVKGTGKDGRVTKEDAEKAQKQAPKPAASKSSSSAAKETAPEAPKVAGERNMKREKM
SSLRKTISKRLVAAKNETAMLTTFNEVNMKPIMDLRKQYKEMFKEKHNVNLGFMSFFTKA
VCVALQEWPAVNAQIDGNEIIYHDFCDVSIAVSAPKGLVVPVIRNAESLSFDQVEKEVVR
LATKARDGKLTIEEMTGGTFTITNGGIFGSMMSTPIINQPQSAILGMHNIVERPMAVNGE
VKILPMMYIALSYDHRIIDGRESVSFLVRLKQLLEDPARLLLGV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagaaatcaaagtccccgctgtgggcgaatccattactgaggttactattggc
caatggtttaaaaatagcggagaatacgtcgaaatggacgaagtgatctgcgaattggaa
tctgacaaggccacttttgaattgaccgcggaagctgacggtatattgaccgtaaaagct
gaagccggtgacacccttgaaatcggggcagttatttgtgagatcgacaccaaggcttca
gcagatgatgccgctccggccaaggaagaaaagaaagaggcacctgcagacagcaaggag
tccaaaggttcttcttcggatagcaaatccggtaaaacaggtgaagttaaggaaatggta
gttcctacagtaggtgaatccattaccgaggtgacgttagcttcttggttgaaggaagat
ggtgattttgtcgaaatggacgagatcatcgccgaggtagattctgataaggcgacgttt
gagctgcctgccgaggcacaagggattttgaaacgggtagcggaagaaggggataccctg
gagatcggaggcttgatctgtaagatcgaagtcgtcgaaggagacgctcccgaagcggat
gatactgcagatacttccaaagaggaaagtacctcgtcagcatcttctagcggatccgga
agttatgcagaaggtcatgcctctcctgctgctgcaaagatccttgctgagaaaggtatc
gatgccaaagaggtaaaaggtacaggcaaagatggaagagtcacgaaagaggatgctgaa
aaggcccagaagcaagcgcctaaaccagctgcatccaaatcttcctcttcagcagcaaaa
gaaacggcacccgaagctcctaaagtagctggagagcgaaatatgaagcgggagaaaatg
tcttcgctccgtaaaaccatctccaagcgattggtagcggccaaaaatgaaacggccatg
cttaccaccttcaatgaggtcaacatgaagccaatcatggacctcaggaagcagtataaa
gaaatgttcaaggaaaagcacaacgtaaaccttgggtttatgtcgttctttaccaaagcg
gtctgcgtagccctacaggaatggccggccgtaaatgcccaaatcgatggcaatgaaatc
atttaccatgatttctgcgatgtgtccatcgcggtatcagcccctaaaggattggtggtt
ccggtgatcagaaatgccgaatcgctgtcatttgatcaggtggagaaagaggtggttcgc
ttggcgaccaaggcccgtgatggtaaattaaccatagaagaaatgacggggggtaccttt
accattaccaatgggggaatctttggttccatgatgtccacaccgatcatcaaccaacct
caatctgcgatccttggaatgcacaatatcgtggaacgaccaatggcggtaaatggtgag
gtgaaaatccttcccatgatgtatatcgccctgtcatacgatcacagaatcatcgatggc
cgtgaatccgtaagcttcctcgttagactgaagcaattgctggaagacccagcgagattg
ctgcttggggtctaa

DBGET integrated database retrieval system