KEGG   Echinicola vietnamensis: Echvi_0772Help
Entry
Echvi_0772        CDS       T02388                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
evi  Echinicola vietnamensis
Pathway
evi00020  Citrate cycle (TCA cycle)
evi00310  Lysine degradation
evi01100  Metabolic pathways
evi01110  Biosynthesis of secondary metabolites
evi01120  Microbial metabolism in diverse environments
evi01130  Biosynthesis of antibiotics
evi01200  Carbon metabolism
Module
evi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
evi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Echvi_0772
  Amino acid metabolism
   00310 Lysine degradation
    Echvi_0772
Enzymes [BR:evi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Echvi_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H LMWPc
Motif
Other DBs
NCBI-ProteinID: AGA77047
UniProt: L0FUT2
Position
complement(868701..870275)
Genome map
AA seq 524 aa AA seqDB search
MSLEIKVPAVGESITEVTIGQWFKNSGEYVEMDEVICELESDKATFELTAEADGILTVKA
EAGDTLEIGAVICEIDTKASADDAAPAKEEKKEAPADSKESKGSSSDSKSGKTGEVKEMV
VPTVGESITEVTLASWLKEDGDFVEMDEIIAEVDSDKATFELPAEAQGILKRVAEEGDTL
EIGGLICKIEVVEGDAPEADDTADTSKEESTSSASSSGSGSYAEGHASPAAAKILAEKGI
DAKEVKGTGKDGRVTKEDAEKAQKQAPKPAASKSSSSAAKETAPEAPKVAGERNMKREKM
SSLRKTISKRLVAAKNETAMLTTFNEVNMKPIMDLRKQYKEMFKEKHNVNLGFMSFFTKA
VCVALQEWPAVNAQIDGNEIIYHDFCDVSIAVSAPKGLVVPVIRNAESLSFDQVEKEVVR
LATKARDGKLTIEEMTGGTFTITNGGIFGSMMSTPIINQPQSAILGMHNIVERPMAVNGE
VKILPMMYIALSYDHRIIDGRESVSFLVRLKQLLEDPARLLLGV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagaaatcaaagtccccgctgtgggcgaatccattactgaggttactattggc
caatggtttaaaaatagcggagaatacgtcgaaatggacgaagtgatctgcgaattggaa
tctgacaaggccacttttgaattgaccgcggaagctgacggtatattgaccgtaaaagct
gaagccggtgacacccttgaaatcggggcagttatttgtgagatcgacaccaaggcttca
gcagatgatgccgctccggccaaggaagaaaagaaagaggcacctgcagacagcaaggag
tccaaaggttcttcttcggatagcaaatccggtaaaacaggtgaagttaaggaaatggta
gttcctacagtaggtgaatccattaccgaggtgacgttagcttcttggttgaaggaagat
ggtgattttgtcgaaatggacgagatcatcgccgaggtagattctgataaggcgacgttt
gagctgcctgccgaggcacaagggattttgaaacgggtagcggaagaaggggataccctg
gagatcggaggcttgatctgtaagatcgaagtcgtcgaaggagacgctcccgaagcggat
gatactgcagatacttccaaagaggaaagtacctcgtcagcatcttctagcggatccgga
agttatgcagaaggtcatgcctctcctgctgctgcaaagatccttgctgagaaaggtatc
gatgccaaagaggtaaaaggtacaggcaaagatggaagagtcacgaaagaggatgctgaa
aaggcccagaagcaagcgcctaaaccagctgcatccaaatcttcctcttcagcagcaaaa
gaaacggcacccgaagctcctaaagtagctggagagcgaaatatgaagcgggagaaaatg
tcttcgctccgtaaaaccatctccaagcgattggtagcggccaaaaatgaaacggccatg
cttaccaccttcaatgaggtcaacatgaagccaatcatggacctcaggaagcagtataaa
gaaatgttcaaggaaaagcacaacgtaaaccttgggtttatgtcgttctttaccaaagcg
gtctgcgtagccctacaggaatggccggccgtaaatgcccaaatcgatggcaatgaaatc
atttaccatgatttctgcgatgtgtccatcgcggtatcagcccctaaaggattggtggtt
ccggtgatcagaaatgccgaatcgctgtcatttgatcaggtggagaaagaggtggttcgc
ttggcgaccaaggcccgtgatggtaaattaaccatagaagaaatgacggggggtaccttt
accattaccaatgggggaatctttggttccatgatgtccacaccgatcatcaaccaacct
caatctgcgatccttggaatgcacaatatcgtggaacgaccaatggcggtaaatggtgag
gtgaaaatccttcccatgatgtatatcgccctgtcatacgatcacagaatcatcgatggc
cgtgaatccgtaagcttcctcgttagactgaagcaattgctggaagacccagcgagattg
ctgcttggggtctaa

DBGET integrated database retrieval system