KEGG   Echinicola vietnamensis: Echvi_1274Help
Entry
Echvi_1274        CDS       T02388                                 

Definition
L-fucose isomerase family protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
evi  Echinicola vietnamensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:evi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1461203..1462915)
Genome map
AA seq 570 aa AA seqDB search
MKATLLSRTVKPATGKPVIGVFAPCDPRIDAASRERSTNIIKHTAESLAGKIKLPDGTAA
EVVYSDVLIDAESQADQVASQFKEAGVSVLVCVPDTWSFPQLTTISLFSHFPKDTPINFT
TGNSATRPGVVYTHATSGAIAQYGKLTHINVGKWPDAGQNPEMSPATLKALVDWCYAAVT
FQGLKGKRVVVFGHDSMGMETALPHVLETRNQFGIEVTRLDMKLLADMLQKESYDKEELK
KLRTWLEGHAGDRLELPDGEKDSKLLDQSLALYLIVRDLMKDIDAIGGGFMSQLEWGSDD
RGIQLPVADIMESLFNSTFDHNGPKAVQPFATEADVQALLTQLFMTWLSGGHPPLFMDFR
KAWDREDLAELAAQNGYQPNGDEPWMKKGFVDGVNSGSASFNWAATPGTEEKEIMKNITF
PKAVDYFYYLGNSVHFISPGKIKGLAARLAYSSLSGMFSMIWDEAETVALPDELAQKICD
GANPTWPHTFVVPKYASMMEYKQYAPANHFHMTWDLEPARLQFWMDFCNVLSVAPWQARP
TFIEEIDRPVPLLYLLNGGEDATKKLKAGK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaccttattatccagaaccgtcaaacctgctaccggaaaaccggtcatcggc
gtttttgccccttgtgatccgcgcatcgatgcggccagcagggaacggagtaccaacatc
atcaaacacaccgccgaatccctcgccggaaaaatcaagctgccagatggaacggccgcc
gaagtcgtctattcggatgtactgatcgatgccgaaagtcaagcagaccaagtggccagc
caatttaaagaggccggcgtcagtgtcctagtctgtgtgcccgacacttggtcatttccg
cagctgaccaccatttccttgttttcccatttccccaaggacaccccgatcaatttcacc
acaggcaacagtgccacccgtccaggcgtcgtgtacacccatgccacgtcaggagccatt
gcccaatacgggaaattgacccatatcaacgtgggcaagtggccggatgctggccaaaac
ccggaaatgagccctgccaccctcaaagccttggtggattggtgctatgcagcggtcacc
ttccaagggctcaaaggaaaacgggtagtggtttttgggcacgattccatgggcatggaa
acagcccttccgcatgtgctcgaaacacgaaaccagtttggcattgaggtgacgcggctg
gacatgaagctcctcgccgacatgctccaaaaggaatcctatgacaaggaagaattgaaa
aaactcagaacttggctggaaggtcatgccggagatcggctggagctccccgatggggaa
aaagacagtaagctgctggaccagagcctggccctttacctgatcgtccgtgacttgatg
aaggatattgatgcgattggtggaggatttatgagccaactggaatggggctctgatgat
cgcggcatacagcttcccgtggccgatatcatggagtcactgtttaacagtacttttgac
cataacggcccaaaagccgtgcagccttttgccacggaagctgatgtgcaggccttgctg
acgcagctgtttatgacttggctatccggagggcatcctccccttttcatggacttcaga
aaagcttgggacagggaagaccttgccgaactggccgcccaaaatggctatcagccaaac
ggtgatgaaccttggatgaaaaaaggatttgtggatggtgtaaattctgggtctgcttct
tttaactgggccgctacgccgggtactgaggaaaaagaaatcatgaaaaacatcaccttc
ccgaaagccgtggactacttttattacttgggcaattcggtgcatttcatctcccctggc
aagatcaaaggccttgctgccaggcttgcgtacagctctctttccggtatgttttcgatg
atctgggatgaagccgaaacagtggcgcttcccgatgaactggcccaaaaaatctgtgac
ggcgccaaccccacctggccccataccttcgtggttcccaaatatgcctccatgatggag
tacaagcaatatgccccggcaaaccactttcacatgacctgggacttggaacccgccagg
ctacagttttggatggacttctgcaatgtgctttccgtagctccttggcaggcgcgtccc
acctttatcgaagaaatagatcggccagtgccactgctgtacctgctcaatggcggggaa
gatgccaccaaaaagctcaaagccgggaaatag

DBGET integrated database retrieval system