KEGG   Echinicola vietnamensis: Echvi_1279Help
Entry
Echvi_1279        CDS       T02388                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
evi  Echinicola vietnamensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:evi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1467458..1468960)
Genome map
AA seq 500 aa AA seqDB search
MDSNKQFILSIDQGTSGTKALVFDAQGKQVAKATVPLKTHYLDGGLVEQDPEDIYQNVLK
AVGICLADFQFQGHPLDAITSCGISNQRETFLLWDKNGAPLYQAVVWQCKRSIGVCDRLK
AAGLEPLIKDKTGLIIDPYFSGTKLIWLYENDPAIATAIDAGEAYFGTVDTWLLYRLTEG
NHYLTDFTNASRTLFFNLDTLDWDRELLDNMGLSGLQLPAVRPSSAEFGVTDFEGLLDAP
LPIFAMIGDSHAAAFGEACFEPGTAKATMGTGCSVLMNVGDERKSSGHGMVSTICWSTEA
QVSYALEGVIVTCGATIEWLKNELGLIQDSRETEAMAKAVTSNQGVYLVPAFSGLGAPHW
DMKRKASLVGMTFDSGKNHIVRAALESIPYQIKDVISAMEEDAQLDLEALNVDGGITANG
FVIDFLADLLEKPVARVGIADVSALGAAYLAGLKAGVFKDLAHLQQLQQKQQTVPNGPAD
SIKAAYAGWQRAVKGNTDNS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaataagcaatttatcctttcgatcgaccaaggtaccagtggtaccaaagca
ctggtgtttgatgcgcagggaaaacaagtggccaaagccaccgtaccgctcaaaacccat
tacctcgacggtggtttggtggagcaggatccggaagacatttaccaaaacgtgctgaaa
gctgtaggcatttgtttggctgactttcagtttcagggccaccccttggatgctatcacc
agctgtggaatctccaaccagcgggagacctttttactttgggacaaaaatggggccccg
ttgtaccaagcggtggtctggcagtgcaagcgttccataggggtttgtgaccggctgaaa
gcagcagggctggaacccctcatcaaggataaaaccggcttgatcattgacccatatttt
tcaggtaccaaactgatttggctatatgaaaatgacccggccatcgctacggccatcgat
gcgggagaagcctacttcggcaccgtggatacttggctactgtaccgactgaccgagggc
aaccattacctgactgatttcaccaatgcttcccgtaccttgttctttaacctggacacc
ttggattgggacagggagctattggataatatggggctttctgggctccaactcccagcg
gtgaggccctcatctgctgaatttggcgtgactgattttgaaggactgctggatgctccc
ctgcccatctttgcgatgattggcgattcgcatgccgccgcctttggggaagcatgcttc
gaaccgggcacggccaaggccaccatgggcaccggctgctccgtcctgatgaacgtcggc
gacgaacgtaaatcctccggtcacggcatggtaagtacgatctgttggagcacggaggca
caagtgagctatgccttggaaggagtgatcgtcacctgtggcgcgaccatcgaatggcta
aaaaatgaactgggactgattcaggacagccgggagaccgaggccatggccaaggccgta
acatccaatcaaggtgtctatttggtgcccgcattcagcggtttgggggctccgcactgg
gacatgaagcgaaaagcctcgctggtgggcatgacctttgacagtggcaaaaaccacatt
gtccgcgcggcgttggagtccattccctatcagatcaaagacgtcatcagcgccatggaa
gaagatgcccagctggatctggaagcgctaaacgtggacggcggcatcactgccaatggt
tttgtcatcgactttttggccgatttattggaaaagcctgtggcaagggttgggattgcc
gatgtttctgcattgggggcagcctatttggccggattgaaggcgggggtttttaaagac
ctggctcatcttcagcagcttcagcaaaaacaacaaaccgtcccaaatgggcctgcagat
tccataaaagctgcctatgcaggttggcaacgggccgttaaaggaaacacagacaacagc
taa

DBGET integrated database retrieval system