KEGG   Echinicola vietnamensis: Echvi_1581Help
Entry
Echvi_1581        CDS       T02388                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
evi  Echinicola vietnamensis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:evi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1818038..1818730)
Genome map
AA seq 230 aa AA seqDB search
MIKIRVFSVLTVFFLVALGTFSCSESQQTSDKEASSSKADTEKENQVPKKTILFFGDSMT
AGYGVDQDEAFPALLQHKIDSLNLPYKVINGGLSGETSASGLTRIDWFLESKPDIFILEL
GGNDGLRGIALSSTKDNLQGIIDKVKEKYPSTKIILAGMQIPPNMGEAYTTDFKEIFPSL
AEQNDLLLIPFLLDGVGGNPDLNQPDGIHPTAEGHKIVAKTVWKYLEPEL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatacgtgtattttctgttttgacagtgttctttttggttgccttgggcaca
ttttcgtgcagtgaaagccagcaaacctccgataaagaagcgtcgtcttccaaagccgat
acggaaaaagaaaatcaagtccctaaaaaaaccattctcttctttggggatagcatgacc
gcaggttatggtgtagatcaggatgaagccttcccagccctgctccagcataaaattgac
agtcttaaccttccctataaggtcatcaatggtggcctgagcggagaaaccagcgccagc
ggattaaccagaatcgattggttcttggagtcaaaaccagatattttcatccttgagctg
ggggggaatgatgggcttagaggcatagcattgtcttccaccaaggacaacctccaaggc
atcattgataaagtcaaagaaaaatacccttccaccaaaatcattctggccggcatgcaa
atcccgccaaatatgggggaagcatacacgacagatttcaaagaaatcttcccttccctt
gcggaacaaaacgacctgctactgatccctttcctgttagatggtgtaggcggaaacccc
gatctcaaccaacctgacggcatccatcccacggccgaaggccataagatcgtcgcaaaa
accgtttggaaataccttgagcctgaattgtaa

DBGET integrated database retrieval system