KEGG   Echinicola vietnamensis: Echvi_1770Help
Entry
Echvi_1770        CDS       T02388                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
evi  Echinicola vietnamensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Echvi_1770
Enzymes [BR:evi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Echvi_1770
Exosome [BR:evi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Echvi_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2079243..2080745)
Genome map
AA seq 500 aa AA seqDB search
MTQNKQFIMALDQGTTSSRAILFDQSGQSIAIAQKDFKQHFPKAGWVEHDAKEIWTSQAA
VILEAIAQAEIEPGQVAGIGITNQRETTILWDRKSGKPLYRAIVWQDRRTSAYCNRLKRE
GYRDMINQKTGLIIDAYFSATKIKWILDNVEGVREKAEKGEVCFGTVDSWLVWKLTNGQQ
HLTDITNASRTMLFNIHDKQWDEELLELFDIPKSILPEVRSSSEVYCTTAGDIFSAKIPI
GGIAGDQQAALFGQRCTQPGMVKTTYGTGCFMVMNTGEKPVQSSNQLLTTIAWEVAGKVH
YALEGSVFIGGAAIQWLRDGLAIFEEAEQSESLATSVEDNGGVYFVPALTGLGAPYWDQD
ARGAFFGITRGTTQAHFARAALEAIAFQVFDVLAAMEKDAGAKTKEMRVDGGASANNFLM
QFQADLLRSEVKRPQITETTALGAAFLAGLAVGYWKDQTELQQLWKEEASFPPKSDRNVT
DELLHFWHKAVQRSKDWVEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaataaacaattcatcatggcgctggaccaaggcactaccagctctagggcc
atactttttgaccaaagcggccaatccattgccattgcccaaaaagattttaaacaacat
tttccgaaagcaggctgggtggagcatgatgccaaggaaatctggacttcccaagcagct
gtcattctggaagccattgcacaagctgaaatcgagcccggccaagtagcgggcattggt
atcaccaaccaacgggaaacgaccattctctgggaccgaaaatcaggaaagccgctgtac
cgtgccatcgtctggcaggatcgacgtacttccgcttattgtaatcgactcaagcgggaa
ggatatcgtgacatgatcaatcaaaaaaccggtttgatcattgacgcctacttttcggct
acgaaaatcaaatggatactggacaatgtagaaggcgtgagggaaaaggccgaaaaagga
gaggtttgttttgggacagtggacagctggctggtatggaagctcaccaatggccaacaa
cacctcacagacatcaccaatgccagtcgtaccatgctgtttaacatccatgataaacaa
tgggacgaagagctattggagctatttgacattcccaagtccattttaccggaagtacgg
tccagtagcgaagtatactgcaccacggcaggagatattttttctgcaaaaatacccatt
ggcggcatcgccggagatcagcaggccgccctcttcggccaacgctgtacccagcccgga
atggtcaaaaccacatacggtaccggctgctttatggtcatgaacacaggtgaaaaaccc
gtacagtccagcaatcaattgctaacgaccatcgcttgggaagtagcgggaaaggtccat
tatgccttggaggggagtgtctttatcggtggtgctgctatccaatggctccgcgatgga
ctcgccatctttgaagaagctgagcaaagtgaatcgctggccaccagtgtagaagacaat
ggaggcgtctattttgtaccagccctcaccggcttaggagcaccctactgggatcaggat
gcacgaggggcgtttttcggcatcaccagaggcactactcaagcccatttcgcccgcgca
gctttggaagccattgcttttcaggtcttcgatgtcttggctgccatggaaaaagatgct
ggtgccaagaccaaagaaatgcgcgtggacggaggagcatctgccaataatttcctgatg
caatttcaagccgacttgctcagaagtgaagtcaaacgcccacagatcacggaaacaacc
gctttgggggctgcatttttagccggtctggccgtgggctactggaaagaccaaacggaa
ctgcagcagttatggaaagaagaggcatcatttcccccaaaatctgatcgaaatgttacc
gatgagctgcttcacttttggcacaaagctgtccaaaggagtaaagactgggtggaagaa
tga

DBGET integrated database retrieval system