KEGG   Echinicola vietnamensis: Echvi_1876Help
Entry
Echvi_1876        CDS       T02388                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
evi  Echinicola vietnamensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Echvi_1876
   00051 Fructose and mannose metabolism
    Echvi_1876
Enzymes [BR:evi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Echvi_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2202933..2204246
Genome map
AA seq 437 aa AA seqDB search
MSKTYFPGIEKIKYEGRDSKNPFAFKFYDENKVVAGKTMKEHFKFAIAYWHSFNATGDDP
FGPGTKTFVWDQAEDALQRAKDKMDAAFEFITKIGAPYYCFHDVDLIDEGSTIEEYESRM
KAITEYAKQKQVETGVKLLWGTANVFSNPRYMNGASTNPDFDVVSWAATQVKNSIDATIA
LGGENYVFWGGREGYMSLLNTDMKRETEHLAKFLTMARDYGRKQGFKGNFLIEPKPMEPT
KHQYDYDSATVVGFLRHYGLDKDFKLNIEVNHATLAGHTFQHELQVAADAGLLGSIDANR
GDYQNGWDTDQFALNLQELTESLLVILEAGGLQGGGVNFDAKLRRNSTDLDDLFHAHIGS
MDAFARALLIANDILEQSEYKALRKKRYASFDGGKGKEFEEGKLTLEDLREHAIATGEPA
STSGKQEMYENIINQYI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacctattttccaggaatagaaaaaatcaagtatgaaggcagggattccaag
aatccatttgcttttaagttttatgacgaaaacaaagtagtggccggcaagaccatgaaa
gagcattttaagtttgccattgcctactggcactcgtttaatgccacaggagatgatcct
tttggcccggggacaaagacttttgtttgggaccaggcagaggatgcccttcagcgggcc
aaagataaaatggatgctgctttcgaatttatcaccaaaattggcgctccttattattgt
ttccatgatgtggatttgatcgatgaaggatccactatcgaggaatatgaaagtcggatg
aaggccatcacggagtatgccaaacaaaaacaagtagaaacgggtgtgaagcttctgtgg
ggtacggccaatgtattcagcaatcctcgctatatgaacggagcctccaccaatcccgat
tttgatgtggtgtcttgggcagctacccaagtgaagaattccattgatgcgaccattgcc
cttggcggtgaaaactacgtgttttggggtggccgtgaagggtacatgtccttgctcaat
accgacatgaagcgtgaaacagagcatttggccaaattcttgaccatggcgcgcgattat
ggacgcaagcaagggtttaaaggaaatttcctgatcgaaccaaaacccatggagcctacc
aagcaccagtacgactatgattcggccacggtggtgggctttttaagacattacgggttg
gacaaggacttcaagctgaacattgaggtgaaccatgcaacgctggccggccatacgttc
cagcacgaacttcaggtagctgcagatgccgggttgttgggcagtattgatgccaaccgt
ggggattaccaaaacggctgggataccgaccagtttgccttgaatttacaggaattgacc
gagtcgctgctggtgattctggaagcgggaggccttcaagggggaggcgtaaactttgac
gcgaagctgagaagaaactctaccgatctggatgaccttttccatgcccatatcgggagt
atggatgcctttgccagggcgttgctgatcgcaaacgatattttggagcaatccgaatac
aaggccttgaggaaaaagcgttacgcttcctttgacggaggcaagggcaaggagtttgag
gaaggcaaattgactttggaagacttaagggagcacgccattgccactggtgagccggca
agcacgagcggtaagcaggagatgtacgagaacattattaaccagtatatctaa

DBGET integrated database retrieval system