KEGG   Echinicola vietnamensis: Echvi_2002Help
Entry
Echvi_2002        CDS       T02388                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
evi  Echinicola vietnamensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Echvi_2002
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Echvi_2002
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Echvi_2002
Enzymes [BR:evi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Echvi_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2353849..2355141
Genome map
AA seq 430 aa AA seqDB search
MKFYSTNNKEHKVSLKEAVIKGLAPDQGLYMPERIPTLPADFIDQLPERSFQEIGYEVIG
AIFGEDLSKEQIKELVDHTLAFDAPLVKVEEEVYTLELFHGPTLAFKDFGARFCSKLMSL
LVKDEKVRVLVATSGDTGSAVANGFYKVPGVEVIILYPSGKVSTLQEKQFTTLGENITAL
EVDGVFDDCQRMVKQAFLDKDLNESMLLTSANSINIARWIPQCLYYFYAYSRLPKGHEKV
VFSVPSGNFGNIAAGMLAERMGLPIETFVAATNVNKIVPDFLKGVPFRPRPSLQTISNSM
DVGNPSNFYRLLDLYGDESKLKEMVKGFFFDDATTREAMATVKAAAGYLMDPHGAVAYLG
LKAYMEEHPGYTGVFLETAHPGKFGDVVEAVHQEKVTLPERLAAFLDGQKKTKLMANDYQ
EFKTYLRSKK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctacagtacaaacaataaagaacacaaagtttccctcaaggaagccgttatc
aagggcttggcgccggaccaagggctttatatgcccgagcggattccgacattgcctgct
gattttatcgatcaactgcccgagcggtcttttcaggagatcggctatgaggtgatagga
gccatttttggagaagacttgagtaaggagcagatcaaggaattggtcgatcataccttg
gcctttgatgctcctttggtgaaggtggaagaagaggtgtatacgctggaattatttcat
gggcctacattggcgtttaaagattttggcgcgcggttttgctcaaaattaatgagcctt
ctcgtaaaagatgagaaagtcagggtgctggtagcgacatccggtgatacgggaagtgcc
gtggccaacggattttataaagtccccggcgtggaagtgatcattctctacccttcgggc
aaagtcagtacccttcaggaaaaacaatttacgacccttggcgaaaacattacggcattg
gaagtggatggggtttttgacgattgtcagcgaatggtgaagcaagcttttctggacaag
gacctgaacgaaagcatgctccttacatctgctaattccatcaatatcgcaaggtggatt
ccgcagtgtttatattatttctatgcttatagtcgtctgccaaaaggacatgaaaaagtg
gtgttttcggtcccaagcgggaattttgggaacatcgctgcggggatgttggccgaaaga
atgggcttgccgatcgagacgtttgtggccgctaccaatgtcaataaaatcgtgccggat
tttctgaaaggtgttccgttccgtccaagaccgtcgctgcaaaccatcagtaatagcatg
gatgtggggaacccgagcaacttttaccggctgctggacttgtacggtgatgaatcgaag
ctgaaggaaatggtaaaaggctttttctttgatgatgccacgacccgggaggccatggct
acggtgaaagcagcagcgggatatttgatggatccacatggagcagtggcctatttgggc
ttaaaagcatacatggaagagcatccggggtataccggcgtattcttggaaacggctcat
cccggtaagtttggagatgtggtcgaagctgtccaccaagaaaaggtgaccctcccagag
cggttggctgccttcctggacgggcagaaaaagacgaaattgatggccaatgactatcag
gaatttaaaacttatttacgttcaaaaaagtaa

DBGET integrated database retrieval system