KEGG   Echinicola vietnamensis: Echvi_2282Help
Entry
Echvi_2282        CDS       T02388                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
evi  Echinicola vietnamensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Echvi_2282
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Echvi_2282
Enzymes [BR:evi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Echvi_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2703716..2705269
Genome map
AA seq 517 aa AA seqDB search
MTVHKIGGISVVLMILTVMFSCEPDPKISAAALIPLPEKVHEAEGAFEINKSTKIHVAQD
AGEMRGVADFLATLLNQSTGYNIQVVDELPESGNYISLGQEGSGEAYKLHVQDDHIQVKA
GSAAGAFWAVQTLRQLLPLAIEEKGPIEGVSWKVPAGEIEDNPVYAYRGSMLDVARHFFD
VNDVKRYIDLMAMYKFNYLHLHLADDQGWRIEIKSWPKLTEIGGSTEVGGGEGGFYTQEE
YKEIVQYAKERFITIVPEIDMPGHTNAALASYPELNCDDEAPELYTGIEVGFSTLCTDKE
VTYQFIDDVVRELVEMTPGPYIHIGGDESHVTALEDYIPFIEQVQDIVNSYDKQAIGWDE
IAHAALRPSTTAQFWAKAENAKMAVEQGAKVLMSPATKAYLDMQYDSTTQLGLHWAAYIE
LDSAYMWEPTELVEGIGKDDILGVEAPLWTETIEKMDDIEYMVFPRLIGIAEIAWTSPDK
RNWDSYKDRLRQHTERLEALEVDYYASPLLKEKEIAE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacataaaataggcggaatttcagtagtgctaatgatcttgaccgtgatgttt
tcatgtgagccagatcccaaaatttcagctgctgctttgattcccttgccggagaaggtg
catgaagcagaaggtgcttttgaaatcaataagtccaccaagatacacgtggcccaggat
gctggagagatgcgtggggtggcggattttttggccacattgctcaatcagtctacggga
tacaatatccaggtggtcgacgaacttccggaatcagggaattacatttctttggggcag
gaaggtagtggagaggcgtataagcttcatgtgcaagacgatcatattcaagtgaaggca
ggttctgcagcgggagctttttgggcagtacagacccttcggcaattattaccgttagcc
atcgaggaaaaagggccgattgaaggagtgtcctggaaggtgccagccggggaaattgaa
gataatcctgtatacgcttatcggggaagcatgctggatgttgccaggcatttttttgat
gtcaatgatgtgaaacgctacattgatttgatggccatgtataaatttaactatctgcac
ttgcatttggctgatgaccagggctggcggatagagatcaagtcttggccaaaactgacc
gaaattggcggtagcacggaagtaggcggtggcgaaggaggtttttatacccaagaagaa
tacaaggaaatcgtgcagtatgcaaaggagcggtttattaccattgtgccggaaatcgac
atgccgggacataccaatgcggctttggcctcatatcctgagctcaattgtgatgatgaa
gccccagagttgtatacaggcattgaagttgggtttagtacactatgtacggacaaggaa
gtcacttatcagtttatcgatgatgtcgtgcgtgaactggtagaaatgacccctgggcct
tatatccacatcggtggagatgagtctcatgtgacggcgttggaagattatattccgttt
attgagcaggtgcaggatatcgtgaattcgtatgataaacaggcgattggctgggatgaa
atagcccatgcggcgttgcggcctagcacgactgcccagttttgggccaaggcagaaaat
gccaagatggctgtggagcaaggtgccaaggtgctcatgtctccggccacaaaggcttac
ctggatatgcagtatgattccaccacacagttgggcctgcattgggcagcgtatatagaa
ctggacagtgcctatatgtgggagcctactgaattggtggagggcatcggtaaggatgat
attcttggcgtggaagcaccgctgtggacggagaccattgaaaagatggatgatatcgaa
tacatggtgtttccccgattgatagggatcgctgagattgcgtggacgtcacccgacaag
cgtaattgggatagttacaaggatcgattgcgccagcatactgaaaggctggaggcattg
gaggtagattattatgcctcgcccttgttaaaagaaaaggaaatagcagagtaa

DBGET integrated database retrieval system