KEGG   Echinicola vietnamensis: Echvi_2282Help
Entry
Echvi_2282        CDS       T02388                                 

Definition
(GenBank) N-acetyl-beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
evi  Echinicola vietnamensis
Pathway
evi00511  Other glycan degradation
evi00520  Amino sugar and nucleotide sugar metabolism
evi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Echvi_2282
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Echvi_2282
Enzymes [BR:evi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Echvi_2282
Chaperones and folding catalysts [BR:evi03110]
 Intramolecular chaperones
  Others
   Echvi_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2 Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: AGA78530
UniProt: L0G135
Position
2703716..2705269
Genome map
AA seq 517 aa AA seqDB search
MTVHKIGGISVVLMILTVMFSCEPDPKISAAALIPLPEKVHEAEGAFEINKSTKIHVAQD
AGEMRGVADFLATLLNQSTGYNIQVVDELPESGNYISLGQEGSGEAYKLHVQDDHIQVKA
GSAAGAFWAVQTLRQLLPLAIEEKGPIEGVSWKVPAGEIEDNPVYAYRGSMLDVARHFFD
VNDVKRYIDLMAMYKFNYLHLHLADDQGWRIEIKSWPKLTEIGGSTEVGGGEGGFYTQEE
YKEIVQYAKERFITIVPEIDMPGHTNAALASYPELNCDDEAPELYTGIEVGFSTLCTDKE
VTYQFIDDVVRELVEMTPGPYIHIGGDESHVTALEDYIPFIEQVQDIVNSYDKQAIGWDE
IAHAALRPSTTAQFWAKAENAKMAVEQGAKVLMSPATKAYLDMQYDSTTQLGLHWAAYIE
LDSAYMWEPTELVEGIGKDDILGVEAPLWTETIEKMDDIEYMVFPRLIGIAEIAWTSPDK
RNWDSYKDRLRQHTERLEALEVDYYASPLLKEKEIAE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacataaaataggcggaatttcagtagtgctaatgatcttgaccgtgatgttt
tcatgtgagccagatcccaaaatttcagctgctgctttgattcccttgccggagaaggtg
catgaagcagaaggtgcttttgaaatcaataagtccaccaagatacacgtggcccaggat
gctggagagatgcgtggggtggcggattttttggccacattgctcaatcagtctacggga
tacaatatccaggtggtcgacgaacttccggaatcagggaattacatttctttggggcag
gaaggtagtggagaggcgtataagcttcatgtgcaagacgatcatattcaagtgaaggca
ggttctgcagcgggagctttttgggcagtacagacccttcggcaattattaccgttagcc
atcgaggaaaaagggccgattgaaggagtgtcctggaaggtgccagccggggaaattgaa
gataatcctgtatacgcttatcggggaagcatgctggatgttgccaggcatttttttgat
gtcaatgatgtgaaacgctacattgatttgatggccatgtataaatttaactatctgcac
ttgcatttggctgatgaccagggctggcggatagagatcaagtcttggccaaaactgacc
gaaattggcggtagcacggaagtaggcggtggcgaaggaggtttttatacccaagaagaa
tacaaggaaatcgtgcagtatgcaaaggagcggtttattaccattgtgccggaaatcgac
atgccgggacataccaatgcggctttggcctcatatcctgagctcaattgtgatgatgaa
gccccagagttgtatacaggcattgaagttgggtttagtacactatgtacggacaaggaa
gtcacttatcagtttatcgatgatgtcgtgcgtgaactggtagaaatgacccctgggcct
tatatccacatcggtggagatgagtctcatgtgacggcgttggaagattatattccgttt
attgagcaggtgcaggatatcgtgaattcgtatgataaacaggcgattggctgggatgaa
atagcccatgcggcgttgcggcctagcacgactgcccagttttgggccaaggcagaaaat
gccaagatggctgtggagcaaggtgccaaggtgctcatgtctccggccacaaaggcttac
ctggatatgcagtatgattccaccacacagttgggcctgcattgggcagcgtatatagaa
ctggacagtgcctatatgtgggagcctactgaattggtggagggcatcggtaaggatgat
attcttggcgtggaagcaccgctgtggacggagaccattgaaaagatggatgatatcgaa
tacatggtgtttccccgattgatagggatcgctgagattgcgtggacgtcacccgacaag
cgtaattgggatagttacaaggatcgattgcgccagcatactgaaaggctggaggcattg
gaggtagattattatgcctcgcccttgttaaaagaaaaggaaatagcagagtaa

DBGET integrated database retrieval system